Identifiers and Description

Gene Model Identifier

TTHERM_00490630

Standard Name

MED3 (Mediator Subunit 3)

Aliases

PreTt08368 | 60.m00165

Description

MED3 hypothetical protein; Subunit 3 of transcriptional regulator Mediator complex. Co-purified with Med31 in AP-MS experiments.

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13533.1 2.0004037638327014e-151
Description: hypothetical protein (298 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:31280994: Garg J, Saettone A, Nabeel-Shah S, Cadorin M, Ponce M, Marquez S, Pu S, Greenblatt J, Lambert JP, Pearlman RE, Fillingham J (2019) The Med31 Conserved Component of the Divergent Mediator Complex in Tetrahymena thermophila Participates in Developmental Regulation. Current biology : CB 29(14):2371-2379.e6
  2. Ref:18515835: Bourbon HM (2008) Comparative genomics supports a deep evolutionary origin for the large, four-module transcriptional mediator complex. Nucleic acids research 36(12):3993-4008

Sequences

>TTHERM_00490630(coding)
ATGAATAAGAATAAGCAAAAATATTTAGTGAAGATAGACCATAATATAAATCTATTATCA
GCAGTAAAAAAGAATTTGATCAATTACTTAGAAGCGATAAAGAATTTACAATCAACCATA
AATAATCCTTAGCTTCCACCCAATTAAAGATAAACTCCTCAGAATGTTGATAAGAAAAAG
ACTAATTTAGAGAAGTCCTTGGAAATGTTTTTGGCAAATTATAAAGAAGTGGAGGACTAA
AAAAATTTCGAAAAGAACTAATAGATTAAGGATGGATTTGAAGAGGTGATAATACAAAAT
CAATATTTCTAGCTTGAAAAGAAACTTAACACTAAGGATATTTAGTATTTTAAAAGAATT
GAGTCAAGTATAGGAATTCTTATTGAGCCAGGAATGATTTCAATACGCAGACCTAATTTA
CCTGGTCAGCCTCTTTCTAATTATTAAATAGTCATTTTTGTGCGCGAAGCAAAATTCCAT
ATGTAAAATAACACTTACTAAACTATATATATTGTATAAGATCTTATTGTTTGCCCAATC
CCTAAGAGATTACAAAGCTAATAGTCTAACTAAAGCATTCTTAGTAATGAACCAGAAAAA
ATTGAAATCCCAGATAAAATCCCTGAAGTATTCAAAGAAATATCTGTGTTTGTTAGAATA
GCTTAGAAAAAATTAGATACAAATGTATTATTCGACATGTTCTTCCCATAAATGAAAACT
AATAAAATTGATTACTTCTCAAAAGTATTTTAATCTTCAACTCTTTGTGACTACTGCAAA
AATTACATGAAACTTAAATCCCCTAAAGAAGGATTTATTCCTCCTACTATTCAATATAAT
AATAAATTCTATCATACATAATGCTTTAAAGAGAAAGAATTTTATTGA


>TTHERM_00490630(gene)
ATGAATAAGAATAAGCAAAAATATTTAGTGAAGATAGACCATAATATAAATCTATTATCA
GCAGTAAAAAAGAATTTGATCAATTACTTAGAAGCGATAAAGAATTTACAATCAACCATA
AATAATCCTTAGCTTCCACCCAATTAAAGATAAACTCCTCAGTAAAAAATAGAATCATGA
TAAATATATACATTTATAATAAAAAATAACTAAATGATTGATTGATAGAAATGATTAAAA
AATTTAAATTAACTTTCAATTTAATTAAATAAAATTCAAGGAATGTTGATAAGAAAAAGA
CTAATTTAGAGAAGTCCTTGGAAATGTTTTTGGCAAATTATAAAGAAGTGGAGGACTAAA
AAAATTTCGAAAAGAACTAATAGATTAAGGATGGATTTGAAGAGGTGATAATACAAAATC
AATATTTCTAGCTTGAAAAGAAACTTAACACTAAGGATATTTAGTATTTTAAAAGAATTG
AGTCAAGTATAGGAATTCTTATTGAGCCAGGAATGATTTCAATACGCAGACCTAATTTAC
CTGGTCAGCCTCTTTCTAATTATTAAATAGTCATTTTTGTGCGCGAAGCAAAATTCCATA
TGTAAAATAACACTTACTAAACTATATATATTGTATAAGATCTTATTGTTTGCCCAATCC
CTAAGAGATTACAAAGCTAATAGTCTAACTAAAGCATTCTTAGTAATGAACCAGAAAAAA
TTGAAATCCCAGATAAAATCCCTGAAGTATTCAAAGAAATATCTGTGTTTGTTAGAATAG
CTTAGAAAAAATTAGATACAAATGTATTATTCGACATGTTCTTCCCATAAATGAAAACTA
ATAAAATTGATTACTTCTCAAAAGTATTTTAATCTTCAACTCTTTGTGACTACTGCAAAA
ATTACATGAAACTTAAATCCCCTAAAGAAGGATTTATTCCTCCTACTATTCAATATAATA
ATAAATTCTATCATACATAATGCTTTAAAGAGAAAGAATTTTATTGA


>TTHERM_00490630(protein)
MNKNKQKYLVKIDHNINLLSAVKKNLINYLEAIKNLQSTINNPQLPPNQRQTPQNVDKKK
TNLEKSLEMFLANYKEVEDQKNFEKNQQIKDGFEEVIIQNQYFQLEKKLNTKDIQYFKRI
ESSIGILIEPGMISIRRPNLPGQPLSNYQIVIFVREAKFHMQNNTYQTIYIVQDLIVCPI
PKRLQSQQSNQSILSNEPEKIEIPDKIPEVFKEISVFVRIAQKKLDTNVLFDMFFPQMKT
NKIDYFSKVFQSSTLCDYCKNYMKLKSPKEGFIPPTIQYNNKFYHTQCFKEKEFY