Identifiers and Description

Gene Model Identifier

TTHERM_00490890

Standard Name

GST17 (Glutathione S-transferase mu 17, TtGSTm17, GSTm17)

Aliases

PreTt08394 | 60.m00191

Description

GST17 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04321.1 7.001141985045207e-89
Description: glutathione S-transferase domain-containing protein (209 aa)
Oxytricha Contig16299.0.g15 7.996041293534585e-17
Description: Glutathione S-transferase, N-terminal domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00490890(coding)
ATGTCAAACAACGATACACTTATTTTGGGATACTGGGCACAACCAGTTAGAGCTCAACCA
ATTAGATACATATTAGAAATAGGTAAGTACCCTTACAAGGAAAATTAGTACAAAACTCCT
GCTGAATGGTTTGAAAAAGATTCCATGTCTCTTGGTTTACAATTCCCCAATCTTCCTTAT
ATCATCAAAGGTGACTTAAAAATCACAGAATCACACAATGTTGCTTAATATGCTATTGAA
GTTTCCAACTAATGCAATTTATAAGGAACTGGCTAATAAAAATACAAGATTGAAAATGTT
AGATTAGTTGCTGATGAAGTGATGATGAAAGTCTTTGGAGCTATTAAGTTGAGCGGAGAA
GCTTAAACAAATGAATTCAAGACCAATATTATCCCTAAGCTCACTCTTTTATAGAAGCAC
TTAGGAAACAAAGTTTATTTCTTTGACAATAAGCTATCTGTCGCTGATATTTACACCTAC
TCTGGTTTGTATATCCTCAAGAATAAATTCCCCGAACAATATCAACCTTTTGCTGCAACC
TTTGATCCCTTTATTAAAAACTTTGAATCAATTCCTCAAATTAAAGAATACCAAAGCTCT
GATCGTTTCCCTAAGTTACGTTGA


>TTHERM_00490890(gene)
ATGTCAAACAACGATACACTTATTTTGGGATACTGGGCACAACCAGTTAGAGCTCAACCA
ATTAGATACATATTAGAAATAGGTAAGTACCCTTACAAGGAAAATTAGTACAAAACTCCT
GCTGAATGGTTTGAAAAAGATTCCATGTCTCTTGGTTTACAATTCCCCAATCTTCCTTAT
ATCATCAAAGGTGACTTAAAAATCACAGAATCACACAATGTTGCTTAATATGCTATTGAA
GTTTCCAACTAATGCAATTTATAAGGAACTGGCTAATAAAAATACAAGATTGAAAATGTT
AGATTAGTTGCTGATGAAGTGATGATGAAAGTCTTTGGAGCTATTAAGTTGAGCGGAGAA
GCTTAAACAAATGAATTCAAGACCAATATTATCCCTAAGCTCACTCTTTTATAGAAGCAC
TTAGGAAACAAAGTTTATTTCTTTGACAATAAGCTATCTGTCGCTGATATTTACACCTAC
TCTGGTTTGTATATCCTCAAGAATAAATTCCCCGAACAATATCAACCTTTTGCTGCAACC
TTTGATCCCTTTATTAAAAACTTTGAATCAATTCCTCAAATTAAAGAATACCAAAGCTCT
GATCGTTTCCCTAAGTTACGTTGA


>TTHERM_00490890(protein)
MSNNDTLILGYWAQPVRAQPIRYILEIGKYPYKENQYKTPAEWFEKDSMSLGLQFPNLPY
IIKGDLKITESHNVAQYAIEVSNQCNLQGTGQQKYKIENVRLVADEVMMKVFGAIKLSGE
AQTNEFKTNIIPKLTLLQKHLGNKVYFFDNKLSVADIYTYSGLYILKNKFPEQYQPFAAT
FDPFIKNFESIPQIKEYQSSDRFPKLR