Identifiers and Description

Gene Model Identifier

TTHERM_00492730

Standard Name

RPE1 (Ribulose 5-Phosphate Epimerase)

Aliases

PreTt04209 | 61.m00196 | 3711.m00044

Description

RPE1 ribulose-phosphate 3-epimerase; ribulose-phosphate 3-epimerase family protein; catalyzes a reaction in the non-oxidative part of the pentose-phosphate pathway

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

  • type II site-specific deoxyribonuclease complex (IEA) | GO:0009359

Molecular Function

Domains

  • ( PF00834 ) ribulose-phosphate 3 epimerase family protein
  • ( TIGR01163 ) ribulose-phosphate 3-epimerase
  • ( TIGR03128 ) 3-hexulose-6-phosphate synthase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12969.1 6.998828886836733e-138
Description: ribulose-phosphate 3-epimerase (228 aa)
WormBase WBGene00017272 4.9994004612166366e-86
Description: Ribulose-phosphate 3-epimerase status:Confirmed UniProt:Q95ZW2 protein_id:CCD69064.1
SGD YJL121C 2.0000012618802033e-84
Description: RPE1 D-ribulose-5-phosphate 3-epimerase, catalyzes a reaction in the non-oxidative part of the pentose-phosphate pathway; mutants are sensitive to oxidative stress
DictyBase DDB_G0278275 7.002185723491005e-79
Description: rpe on chromosome: 3 position 603034 to 603814
Stentor Coeruleus SteCoe_38290 1.462486227251231e-31
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00492730(coding)
ATGTCTGAAAAACAATTATAGGCTATTATAGCTCCTTCAATTTTATCAGCTGATCTTTCA
AGCCTTGCTGATGAATGTTAAAAGCTTAATGACTAAGGCGCAGATTGGTTACATATTGAT
GTCATGGATGGCCACTTTGTCCCAAACTTCACTTTTGGTTAAACTGTTGTTAAGTGCCTC
AGAAAGAAAGTCAAAGGATTTTTTGATTGCCATTTAATGATTTCTGAACCCTAAAAATGG
GTTAAAGATTTCCATAATGCAGGAGCAGATCAATATACATTCCATTACGAAGCTGTTGAA
AATCAAGAGTAGCTCTGCAAAGAAATCAAGGAAACTGGAATGAGGGTAGGAATTGCTATT
AAACCAAAAACTTAAATCGAAGATAAACTTTTACAACTTATTGATAGTAATTTAGTTGAC
ATGGTTTTAATTATGACAGTAGAACCTGGTTTTGGTGGATAAAAGTTTATGTAAGACATG
ATGTAAAAAGTTGAGCTTTTAAGAAGAAAATATCCTAAGCTAGATATTTAGGTTGATGGA
GGTATAGTATGTGAAAACATCGATATAGTTGCTAAAGCTGGAGCAAATGTTATTGTCTCA
GGTTCAGGTATAGTAAATCATGCTGATCCTAAAAAAGCTATGGCTTTTATGAAAGAAAGA
GTTTAGTTTTTTATTTCTGACAATGAAAATCAAATTTAATAGTAAAAGGATTGA


>TTHERM_00492730(gene)
ATGTCTGAAAAACAATTATAGGCTATTATAGCTCCTTCAATTTTATCAGCTGATCTTTCA
AGCCTTGCTGATGAATGTTAAAAGCTTAATGACTAAGGCGCAGATTGGTTACATATTGAT
GTCATGGTACTTAAAATTACTTGTGCTTTCATAATTTTTTAATAATTTATTTAATTAATA
GGATGGGTAAATAGTTTTATAGTTTTCATAATAGAATTCTAGCAAGAAATGAATGAACAA
ATAGATTGAATAATTCAATAAATTTATATTAAATACAATTATTTTTTAAATTAGCCACTT
TGTCCCAAACTTCACTTTTGGTTAAACTGTTGTTAAGTGCCTCAGAAAGAAAGTCAAAGG
ATTTTTTGATTGCCATTTAATGATTTCTGAACCCTAAAAATGGGTTAAAGATTTCCATAA
TGCAGGAGCAGATCAATATACATTCCATTACGAAGCTGTTGGTATAGCATTAAATATAAT
TCAAGGCTAATTGGTCAATAATAATAATTTTTTAAATAGAAAATCAAGAGTAGCTCTGCA
AAGAAATCAAGGAAACTGGAATGAGGGTAGGAATTGCTATTAAACCAAAAACTTAAATCG
AAGATAAACTTTTACAACTTATTGATAGTAATTTAGTTGACATGGTTTTAATTATGACAG
TAGGTAATATCACTAAAAAAATAAAATTCATATCTTTTAAACAATATTTAATTTTTTTTA
GAACCTGGTTTTGGTGGATAAAAGTTTATGTAAGACATGATGTAAAAAGTTGAGCTTTTA
AGAAGAAAATATCCTAAGCTAGATATTTAGGTTGATGGAGGTATAGTATGTGAAAACATC
GATATAGTTGCTAAAGCTGGAGCAAATGTTATTGTCTCAGGTTCAGGTATAGTAAATCAT
GCTGATCCTAAAAAAGCTATGGCTTTTATGAAAGAAAGAGTTTAGTTTTTTATTTCTGAC
AATGAAAATCAAATTTAATAGTAAAAGGATTGA


>TTHERM_00492730(protein)
MSEKQLQAIIAPSILSADLSSLADECQKLNDQGADWLHIDVMDGHFVPNFTFGQTVVKCL
RKKVKGFFDCHLMISEPQKWVKDFHNAGADQYTFHYEAVENQEQLCKEIKETGMRVGIAI
KPKTQIEDKLLQLIDSNLVDMVLIMTVEPGFGGQKFMQDMMQKVELLRRKYPKLDIQVDG
GIVCENIDIVAKAGANVIVSGSGIVNHADPKKAMAFMKERVQFFISDNENQIQQQKD