Identifiers and Description

Gene Model Identifier

TTHERM_00497540

Standard Name

SHQ1 (Small nucleolar RNAs of the box H/ACA family Quantitative accumulation)

Aliases

PreTt06919 | 62.m00203 | 3715.m00064

Description

SHQ1-like protein; Homolog of S. cerevisiae SHQ1 chaperone protein required for the assembly of box H/ACA snoRNPs

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12727.1 9.997093137033517e-262
Description: hypothetical protein (432 aa)
Oxytricha Contig19252.0.g51 3.0009061039838537e-46
Description: SHQ1 protein
WormBase WBGene00021655 7.996378988338516e-41
Description: Protein SHQ1 homolog status:Confirmed UniProt:Q9TYM6 protein_id:CCD71630.1
DictyBase DDB_G0269304 2.0008113830639685e-30
Description: DDB_G0269304 on chromosome: 1 position 2484101 to 2485936
SGD YIL104C 7.996210139153865e-29
Description: SHQ1 Chaperone protein required for the assembly of box H/ACA snoRNPs and thus for pre-rRNA processing, forms a complex with Naf1p and interacts with H/ACA snoRNP components Nhp2p and Cbf5p; homology with known Hsp90p cochaperones
Stentor Coeruleus SteCoe_16006 5.74952226429356e-19
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00497540(coding)
ATGATCATCCCCTAATTTAAGCTTACTCAGGATAGTAAATACGTAGTAGCAGTTATTCGT
ATTCCTTATGTTAAAATAAGTAATGCAGAATTCTATATTGAAGGAAGGAACTTTAAATTC
TTTTTGCATCCTTACCTTTTATCAATAGAATTTAAAAATGATTTATTTAAGTCTGATGAA
CCAGCTGCTGCTTCATACAATCATGATACCTATGAGTTAACAGTTAAAATTTAGAAGGCT
ACTGAAGGTGAGCATTTTGAAGATTTAGATATGATAACTTAATTGCTTGCAGCTAGTAGA
AAAAAAGAAGTGAAAAAACCTGAATAGAAAAAAAATAAAAAACCATTAATCGAAGTAATA
GGAGAGGCAGATCATACTGAATAGACTAATAACGATGAAATTGAAGAGATCAAATAGCAA
GTTGAGAACTTGGTTTTGTCCTAAGACGCATATGCTTATGGATTTAATTAATAAACTAAA
GGTTATTTCTAAGATCTTGGTGAAGAAATATTTGAAATTGGTCACTTTAACCCAGACGAA
ATACCTATAAGTGATAGAATTAATTTAAGAAATGAATATGTAAATAGCAAGTTTGATGAA
GATGCTTATATCTATGATACATTTGAAAATGAGGAGATAGACTCATATATTAAATTAAAT
TTAGAATTTTTATCAAAAGTAGCTTCAATTAATTAAGATACAAGCTCTTCTTACACTCCC
GAAGAATGGAACTAGTTAAAAAAATTGCCAAATAAAGAATTCATAATAAATAATAAAAAT
AAATGTTTGATGGAAATTATTGATATCTTGTTTGCATTTGCATACGAATTAAGATGTATG
GGAGGAGAATTTTCTTGTGAAAGTGCTGCAACTATAAACTATTTATCAAGTGTTTTGAGC
TGTTTCATCTGCGATAATACCCTGAACGAAATAATCAGATAGTGCTACAGAAGGGCTTTA
ACTTTCCCTATGTTAAGAAATTTTAAATTAATTTAATAGGCATAACAGGATTTAGTAATA
ATACTTTAAAGTGGTAGAGCTGGAGTTCTTAAAACTTTACTTTAAATTAAATACTTGTTT
GAAGTTAACGAACCTAGATACCATTTAAATAATTTATACATTGAAGATTTTTGTATATGG
GTTTAAACACTCAAAGATGAAGATTTTTAAAATCTTGCAGGGCAAATTTAACAGATAGAA
ATTAATAAAAAAGATCTGGATCTCAATTTAGTAGAAATAGATTAAGACTGTGAATAAATG
CTTCTTGAATAATAAGAAAGTGATAAGCATGATTGA


>TTHERM_00497540(gene)
ATGATCATCCCCTAATTTAAGCTTACTCAGGATAGTAAATACGTAGTAGCAGTTATTCGT
ATTCCTTATGTTAAAATAAGTAATGCAGAATTCTATATTGAAGGAAGGAACTTTAAATTC
TTTTTGCATCCTTACCTTTTATCAATAGAATTTAAAAATGATTTATTTAAGTCTGATGAA
CCAGCTGCTGCTTCATACAATCATGATACCTATGAGTTAACAGTTAAAATTTAGAAGGCT
ACTGAAGGTGAGCATTTTGAAGATTTAGATATGATAACTTAATTGCTTGCAGCTAGTAGA
AAAAAAGAAGTGAAAAAACCTGAATAGAAAAAAAATAAAAAACCATTAATCGAAGTAATA
GGAGAGGCAGATCATACTGAATAGACTAATAACGATGAAATTGAAGAGATCAAATAGCAA
GTTGAGAACTTGGTTTTGTCCTAAGACGCATATGCTTATGGATTTAATTAATAAACTAAA
GGTTATTTCTAAGATCTTGGTGAAGAAATATTTGAAATTGGTCACTTTAACCCAGACGAA
ATACCTATAAGTGATAGAATTAATTTAAGAAATGAATATGTAAATAGCAAGTTTGATGAA
GATGCTTATATCTATGATACATTTGAAAATGAGGAGATAGACTCATATATTAAATTAAAT
TTAGAATTTTTATCAAAAGTAGCTTCAATTAATTAAGATACAAGCTCTTCTTACACTCCC
GAAGAATGGAACTAGTTAAAAAAATTGCCAAATAAAGAATTCATAATAAATGTAAATAAA
ATTACTTATTTTAAATTTAAAAAAAAGATAAATATTCAAAAATAATTTTTAATTTTTTAA
ACAAACTAGAATAAAAATAAATGTTTGATGGAAATTATTGATATCTTGTTTGCATTTGCA
TACGAATTAAGATGTATGGGAGGAGAATTTTCTTGTGAAAGTGCTGCAACTATAAACTAT
TTATCAAGTGTTTTGAGCTGTTTCATCTGCGATAATACCCTGAACGAAATAATCAGATAG
TGCTACAGAAGGGCTTTAACTTTCCCTATGTTAAGAAATTTTAAATTAATTTAATAGGCA
TAACAGGATTTAGTAATAATACTTTAAAGTGGTAGAGCTGGAGTTCTTAAAACTTTACTT
TAAATTAAATACTTGTTTGAAGTTAACGAACCTAGATACCATTTAAATAATTTATACATT
GAAGATTTTTGTATATGGGTTTAAACACTCAAAGATGAAGATTTTTAAAATCTTGCAGGG
CAAATTTAACAGATAGAAATTAATAAAAAAGATCTGGATCTCAATTTAGTAGAAATAGAT
TAAGACTGTGAATAAATGCTTCTTGAATAATAAGAAAGTGATAAGCATGATTGA


>TTHERM_00497540(protein)
MIIPQFKLTQDSKYVVAVIRIPYVKISNAEFYIEGRNFKFFLHPYLLSIEFKNDLFKSDE
PAAASYNHDTYELTVKIQKATEGEHFEDLDMITQLLAASRKKEVKKPEQKKNKKPLIEVI
GEADHTEQTNNDEIEEIKQQVENLVLSQDAYAYGFNQQTKGYFQDLGEEIFEIGHFNPDE
IPISDRINLRNEYVNSKFDEDAYIYDTFENEEIDSYIKLNLEFLSKVASINQDTSSSYTP
EEWNQLKKLPNKEFIINNKNKCLMEIIDILFAFAYELRCMGGEFSCESAATINYLSSVLS
CFICDNTLNEIIRQCYRRALTFPMLRNFKLIQQAQQDLVIILQSGRAGVLKTLLQIKYLF
EVNEPRYHLNNLYIEDFCIWVQTLKDEDFQNLAGQIQQIEINKKDLDLNLVEIDQDCEQM
LLEQQESDKHD