Identifiers and Description

Gene Model Identifier

TTHERM_00498190

Standard Name

HHF1 (Histone H Four 1)

Aliases

PreTt06984 | 62.m00268 | 3715.m00129

Description

HHF1 predicted protein; Histone H4; one of the four histones (H2A, H2B, H3 and H4) that comprise the protein core of the eukaryotic nucleosome; adjacent to HHT2; encoded protein identical to Hhf2p; expressed during macronuclear S-phase; CENP-T/Histone H4, histone fold

Genome Browser (Macronucleus)

Full Screen View


Genome Browser (Micronucleus)

Full Screen View

External Links

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • 3-keto-sphinganine metabolic process (IEA) | GO:0006666
  • cellular response to dopamine (IEA) | GO:1903351
  • chromatin assembly or disassembly (ISS) | GO:0006333
  • commissural neuron axon guidance (IEA) | GO:0071679
  • heme A biosynthetic process (IEA) | GO:0006784
  • heme biosynthetic process (IEA) | GO:0006783
  • induction of apoptosis by extracellular signals (IEA) | GO:0008624
  • negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process (IEA) | GO:1902647
  • negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902642
  • negative regulation of chemokine-mediated signaling pathway (IEA) | GO:0070100
  • negative regulation of PERK-mediated unfolded protein response (IEA) | GO:1903898
  • neutral lipid metabolic process (IEA) | GO:0006638
  • nucleotide-binding oligomerization domain containing 2 signaling pathway (IEA) | GO:0070431
  • obsolete extracellular carbohydrate transport (IEA) | GO:0006859
  • obsolete mRNA endonucleolytic cleavage involved in unfolded protein response (IEA) | GO:0070055
  • obsolete regulation of histone H3-K27 methylation (IEA) | GO:0061085
  • obsolete regulation of nucleic acid-templated transcription (IEA) | GO:1903506
  • obsolete response to long exposure to lithium ion (IEA) | GO:0043460
  • ommochrome biosynthetic process (IEA) | GO:0006727
  • photosynthetic NADP+ reduction (IEA) | GO:0009780
  • plant-type cell wall modification (IEA) | GO:0009827
  • positive regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902643
  • positive regulation of dendrite extension (IEA) | GO:1903861
  • positive regulation of oxidative phosphorylation (IEA) | GO:1903862
  • positive regulation of phospholipid translocation (IEA) | GO:0061092
  • positive regulation of proteasomal protein catabolic process (IEA) | GO:1901800
  • propan-2-ol biosynthetic process (IEA) | GO:1902640
  • protein localization to medial cortex (IEA) | GO:0071574
  • protein localization to old growing cell tip (IEA) | GO:1903858
  • regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process (IEA) | GO:1902646
  • regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902641
  • regulation of bile acid metabolic process (IEA) | GO:1904251
  • regulation of cytokinin dehydrogenase activity (IEA) | GO:1903856
  • regulation of phosphorus utilization (IEA) | GO:0006795
  • regulation of plant epidermal cell differentiation (IEA) | GO:1903888
  • striated muscle myosin thick filament assembly (IEA) | GO:0071688
  • tertiary alcohol biosynthetic process (IEA) | GO:1902645
  • transcription by RNA polymerase V (IEA) | GO:0001060

Domains

  • ( PF15511 ) Centromere kinetochore component CENP-T histone fold

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

GeneMania

Tetrahymena Stock Center

  • ( SD02321 ) Micronucleus: HHF1 ko with neo2 cassette
  • ( SD02322 ) Micronucleus: HHF1 ko with neo2 cassette
  • ( SD02579 ) Micronucleus: Neo KO of all major HHT genes and HHF genes Macronucleus: GFP tagged chimeric H3
  • ( SD02580 ) Micronucleus: Neo KO of all major HHT genes and HHF genes Macronucleus: GFP tagged chimeric H3
  • ( SD02581 ) Micronucleus: Neo KO of all major HHT genes and HHF genes Macronucleus: GFP tagged chimeric H3
  • ( SD02582 ) Micronucleus: Neo KO of all major HHT genes and HHF genes Macronucleus: GFP tagged chimeric H3
  • ( SD02583 ) Micronucleus: Neo KO of all major HHT genes and HHF genes Macronucleus: GFP tagged chimeric H3
  • ( SD02584 ) Micronucleus: Neo KO of all major HHT genes and HHF genes Macronucleus: GFP tagged chimeric H3
  • ( SD02638 ) Micronucleus: Neo KO of all major HHT genes and HHF genes Macronucleus: GFP H3.2 with wt HHF2
  • ( SD02639 ) Micronucleus: Neo KO of all major HHT genes and HHF genes Macronucleus: GFP H3.3 with wt HHF2 into HHT2HHF2 loccus
  • ( SD02642 ) Micronucleus: Neo KO of all major HHT genes and HHF genes Macronucleus: GFP H3.4
  • ( SD02692 ) Micronucleus: Neo KO of all major HHT genes and HHF genes Macronucleus: GFP tagged chimeric H3

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):
  2. Ref:14755052: Liu Y, Mochizuki K, Gorovsky MA (2004) Histone H3 lysine 9 methylation is required for DNA elimination in developing macronuclei in Tetrahymena. Proceedings of the National Academy of Sciences of the United States of America 101(6):1679-84
  3. Ref:12665578: Ren Q, Gorovsky MA (2003) The nonessential H2A N-terminal tail can function as an essential charge patch on the H2A.Z variant N-terminal tail. Molecular and cellular biology 23(8):2778-89
  4. Ref:12522258: Zilberman D, Cao X, Jacobsen SE (2003) ARGONAUTE4 control of locus-specific siRNA accumulation and DNA and histone methylation. Science (New York, N.Y.) 299(5607):716-9
  5. Ref:14661947: Poux AN, Marmorstein R (2003) Molecular basis for Gcn5/PCAF histone acetyltransferase selectivity for histone and nonhistone substrates. Biochemistry 42(49):14366-74
  6. Ref:14536085: Clements A, Poux AN, Lo WS, Pillus L, Berger SL, Marmorstein R (2003) Structural basis for histone and phosphohistone binding by the GCN5 histone acetyltransferase. Molecular cell 12(2):461-73
  7. Ref:11972045: Dou Y, Gorovsky MA (2002) Regulation of transcription by H1 phosphorylation in Tetrahymena is position independent and requires clustered sites. Proceedings of the National Academy of Sciences of the United States of America 99(9):6142-6
  8. Ref:12351775: Jenuwein T (2002) Molecular biology. An RNA-guided pathway for the epigenome. Science (New York, N.Y.) 297(5590):2215-8
  9. Ref:11891286: Shang Y, Song X, Bowen J, Corstanje R, Gao Y, Gaertig J, Gorovsky MA (2002) A robust inducible-repressible promoter greatly facilitates gene knockouts, conditional expression, and overexpression of homologous and heterologous genes in Tetrahymena thermophila. Proceedings of the National Academy of Sciences of the United States of America 99(6):3734-9
  10. Ref:12297044: Taverna SD, Coyne RS, Allis CD (2002) Methylation of histone h3 at lysine 9 targets programmed DNA elimination in tetrahymena. Cell 110(6):701-11
  11. Ref:11784863: Crosio C, Fimia GM, Loury R, Kimura M, Okano Y, Zhou H, Sen S, Allis CD, Sassone-Corsi P (2002) Mitotic phosphorylation of histone H3: spatio-temporal regulation by mammalian Aurora kinases. Molecular and cellular biology 22(3):874-85
  12. Ref:12123289: Waterborg JH (2002) Dynamics of histone acetylation in vivo. A function for acetylation turnover? Biochemistry and cell biology = Biochimie et biologie cellulaire 80(3):363-78
  13. Ref:12455963: Duharcourt S, Yao MC (2002) Role of histone deacetylation in developmentally programmed DNA rearrangements in Tetrahymena thermophila. Eukaryotic cell 1(2):293-303
  14. Ref:11751634: Briggs SD, Bryk M, Strahl BD, Cheung WL, Davie JK, Dent SY, Winston F, Allis CD (2001) Histone H3 lysine 4 methylation is mediated by Set1 and required for cell growth and rDNA silencing in Saccharomyces cerevisiae. Genes & development 15(24):3286-95
  15. Ref:11467741: Green GR (2001) Phosphorylation of histone variant regions in chromatin: unlocking the linker? Biochemistry and cell biology = Biochimie et biologie cellulaire 79(3):275-87
  16. Ref:11135657: Tan S (2001) One HAT size fits all? Nature structural biology 8(1):8-10
  17. Ref:11112280: Trievel RC, Li FY, Marmorstein R (2000) Application of a fluorescent histone acetyltransferase assay to probe the substrate specificity of the human p300/CBP-associated factor. Analytical biochemistry 287(2):319-28
  18. Ref:9396628: Fogel GB, Brunk CF (1997) Expression of Tetrahymena histone H4 in yeast. Biochimica et biophysica acta 1354(2):116-26
  19. Ref:8760889: Liu X, Gorovsky MA (1996) Cloning and characterization of the major histone H2A genes completes the cloning and sequencing of known histone genes of Tetrahymena thermophila. Nucleic acids research 24(15):3023-30
  20. Ref:8415695: Kahn RW, Andersen BH, Brunk CF (1993) Transformation of Tetrahymena thermophila by microinjection of a foreign gene. Proceedings of the National Academy of Sciences of the United States of America 90(20):9295-9
  21. Ref:1885002: Lin R, Cook RG, Allis CD (1991) Proteolytic removal of core histone amino termini and dephosphorylation of histone H1 correlate with the formation of condensed chromatin and transcriptional silencing during Tetrahymena macronuclear development. Genes & development 5(9):1601-10
  22. Ref:3360847: Richman R, Chicoine LG, Collini MP, Cook RG, Allis CD (1988) Micronuclei and the cytoplasm of growing Tetrahymena contain a histone acetylase activity which is highly specific for free histone H4. The Journal of cell biology 106(4):1017-26
  23. Ref:3822803: Horowitz S, Bowen JK, Bannon GA, Gorovsky MA (1987) Unusual features of transcribed and translated regions of the histone H4 gene family of Tetrahymena thermophila. Nucleic acids research 15(1):141-60
  24. Ref:3785221: Pederson DS, Shupe K, Bannon GA, Gorovsky MA (1986) Formation of stable chromatin structures on the histone H4 gene during differentiation in Tetrahymena thermophila. Molecular and cellular biology 6(8):3014-7
  25. Ref:3023930: Harrison GS, Findly RC, Karrer KM (1986) Site-specific methylation of adenine in the nuclear genome of a eucaryote, Tetrahymena thermophila. Molecular and cellular biology 6(7):2364-70
  26. Ref:6322129: Bannon GA, Bowen JK, Yao MC, Gorovsky MA (1984) Tetrahymena H4 genes: structure, evolution and organization in macro- and micronuclei. Nucleic acids research 12(4):1961-75

Sequences 

>TTHERM_00498190(coding)
ATGGCCGGTGGTAAAGGTGGTAAAGGTATGGGTAAAGTCGGAGCCAAGAGACACTCCAGA
AAGTCTAACAAGGCTTCCATTGAAGGTATTACTAAGCCCGCTATCAGAAGATTAGCTAGA
AGAGGTGGTGTTAAGAGAATTTCCTCTTTCATTTACGACGACTCCAGACAAGTCTTGAAG
TCTTTCTTAGAAAACGTTGTTAGAGACGCTGTCACTTACACTGAACACGCTAGAAGAAAA
ACCGTCACTGCTATGGACGTTGTCTACGCCCTCAAGAGACAAGGCAGAACTCTCTATGGT
TTCGGTGGTTGA



>TTHERM_00498190(gene)
TTTATAAATAATTTTAAAACAATAAATAGAAAAACAAATAAGATTATAAAAACTTACAAA
AATGGCCGGTGGTAAAGGTGGTAAAGGTATGGGTAAAGTCGGAGCCAAGAGACACTCCAG
AAAGTCTAACAAGGCTTCCATTGAAGGTATTACTAAGCCCGCTATCAGAAGATTAGCTAG
AAGAGGTGGTGTTAAGAGAATTTCCTCTTTCATTTACGACGACTCCAGACAAGTCTTGAA
GTCTTTCTTAGAAAACGTTGTTAGAGACGCTGTCACTTACACTGAACACGCTAGAAGAAA
AACCGTCACTGCTATGGACGTTGTCTACGCCCTCAAGAGACAAGGCAGAACTCTCTATGG
TTTCGGTGGTTGAACAAAATATTTATCTTAAAAAATTAAAAAGTAAAAAGCTGCATGCTT
ACTCAAAGGTAATAGTGTAATTATCTAGTTCTTTTATCTGAGAGAGTATGCTTTTTTCTA
TCGAGTGTTAGTGTAGCAATTTTCTAAAGTGCATTGAGAGATTGAGACAGAAATGTTTAG
AACTTATTCACAATAAATTAACTTAAGAAAAATAATAACTTACTTAATCAATTCACAATT
AGCCATTATGAATAACTAAACTAAAACATAAAGCTAATTTATTACTTATACATAAAGGCT
TTATTAATAATTAATTAAATATACCAGTTTAATGAAATTTATACTAATCTTTTTCTAATT
TAATATTATTATGTGTTTAACTTTAAGTATTCTCCTTAATTTCTTATTGCACTACTCTCA
TCTTATCCTCATTCATTTTTCTATATCAAATTTTAATTTTTTTCTACTTTCTTTCCATTT
AAGATTTTTCTAAATTCCCTTTT



>TTHERM_00498190(protein)
MAGGKGGKGMGKVGAKRHSRKSNKASIEGITKPAIRRLARRGGVKRISSFIYDDSRQVLK
SFLENVVRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG