Identifiers and Description

Gene Model Identifier

TTHERM_00499480

Standard Name

MRNC03 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt07991 | 63.m00169 | 3716.m00023

Description

MORN motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09685.1 6.0028450615922e-38
Description: hypothetical protein (735 aa)
Oxytricha Contig5936.0.g29 0.0000000006000548789370351
Description: MORN repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00499480(coding)
ATGAGAAATTTAAGAGGTAAAATACAAACCTTTTATTCTAAAGAAGGGTTGAAATCTAAA
GAGTATAAAACAGGTATTTACTAAGGTGAGTATAAAAACTAAAAAGGTAATTTAAGAGAA
GGAAAAGGAGTGTTCTATTGGTATGGAGGTTAGATATACATAGGGCAATGGCAAAATGAT
TAGATTGAAGGATATGGAAGAGTTTATTTTCCTTATGGAGGATAGTTTATAGGATTCTTT
AAATAAAATAAAGCTTGTGGAATTGGTATTATGACCCTTAGAAATTAAAAAATATATGCT
GGGAACTGA


>TTHERM_00499480(gene)
ATGAGAAATTTAAGAGGTAAAATACAAACCTTTTATTCTAAAGAAGGGTTGAAATCTAAA
GAGTATAAAACAGGTATTTACTAAGGTGAGTATAAAAACTAAAAAGGTAATTTAAGAGAA
GGAAAAGGAGTGTTCTATTGGTATGGAGGTTAGATATACATAGGGCAATGGCAAAATGAT
TAGATTGAAGGATATGGAAGAGTTTATTTTCCTTATGGAGGATAGTTTATAGGATTCTTT
AAATAAAATAAAGCTTGTGGAATTGGTATTATGACCCTTAGAAATTAAAAAATATATGCT
GGGAACTGA


>TTHERM_00499480(protein)
MRNLRGKIQTFYSKEGLKSKEYKTGIYQGEYKNQKGNLREGKGVFYWYGGQIYIGQWQND
QIEGYGRVYFPYGGQFIGFFKQNKACGIGIMTLRNQKIYAGN