Identifiers and Description

Gene Model Identifier

TTHERM_00499550

Standard Name

GST53 (Glutathione S-transferase theta 4, TtGSTt4, GSTt4)

Aliases

PreTt07998 | 63.m00176 | 3716.m00030

Description

GST53 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain
  • ( TIGR01262 ) maleylacetoacetate isomerase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09679.1 2.9990203769197855e-115
Description: glutathione S-transferase domain-containing protein (233 aa)
Oxytricha Contig3600.0.g61 3.000619078166531e-39
Description: Glutathione S-transferase, C-terminal domain
DictyBase DDB_G0287793 2.00017271388466e-38
Description: DDB_G0287793 on chromosome: 5 position 710171 to 710938
Stentor Coeruleus SteCoe_30380 1.5628821893349888e-18
Description: None
SGD YNL229C 0.0000020007268868677913
Description: URE2 Nitrogen catabolite repression transcriptional regulator that acts by inhibition of GLN3 transcription in good nitrogen source; has glutathione peroxidase activity and can mutate to acquire GST activity; altered form creates [URE3] prion
WormBase WBGene00001753 0.000004000864880866421
Description: locus:gst-5 Probable glutathione S-transferase 5 status:Confirmed UniProt:Q09596 protein_id:CAA86859.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00499550(coding)
ATGAAAATCTTTATTGATTGGATTAGCTAGCCATCTCGAGCAGTAGTTACTTACTGCTTA
ATTGAAAATATACCACATGAGATTATACAAGTTAGAGTAAATGCTTTAGAGCATCGCAAA
CCAGAGTATATTTAAATAAATCCAAGCGCAAAAGTTCCAGCTATTTCAGATAGATTAGAA
AATGGAGAAATATTTAACTTATTTGAAAGCCATGCTATCATGAGATATTTAGCAGATAGA
TATAATAAGTTTAAGCTTTATCCCAAAGATAATATTTAGCTAAGAGCTCTAATAAATAGT
TATTTAGACTGGCACCATAATAACACAAGAAAGTGTGGAGCTTATTTATTTGACTTATAT
TCATCAGGTGTACTAGGAATAAAACCAAAGAATAACATTGAAACGCTATATAAAGAAATT
GAAATTATTTTAAAATTCATTGATTAAATTTGGCTTCAAGAAGGAAAAAATAAGTTTATT
GGAAATAATATTTAGCTTACAATAGCTGACATATCTTGCTATTGCGAAGTATCTCAAATG
ATAATAGATTCTTATGATTTTAAAAATAAAACACCTAATTTATACAACTGGATGAAAAGA
ATTGAATAAATACCAGAAATTTAGTAAACCCATTAAATTTTATTCAAACTAGCTCCAAAA
ATGTCATAAAACAAAATAAAACCTAATCTTTGA


>TTHERM_00499550(gene)
ATGAAAATCTTTATTGATTGGATTAGCTAGCCATCTCGAGCAGTAGTTACTTACTGCTTA
ATTGAAAATATACCACATGAGATTATACAAGTTAGAGTAAATGCTTTAGAGCATCGCAAA
CCAGAGTATATTTAAATAAATCCAAGCGCAAAAGTTCCAGCTATTTCAGATAGATTAGAA
AATGGAGAAATATTTAACTTATTTGAAAGCCATGCTATCATGAGATATTTAGCAGATAGA
TATAATAAGTTTAAGCTTTATCCCAAAGATAATATTTAGCTAAGAGCTCTAATAAATAGT
TATTTAGACTGGCACCATAATAACACAAGAAAGTGTGGAGCTTATTTATTTGACTTATAT
TCATCAGGTGTACTAGGAATAAAACCAAAGAATAACATTGAAACGCTATATAAAGAAATT
GAAATTATTTTAAAATTCATTGATTAAATTTGGCTTCAAGAAGGAAAAAATAAGTTTATT
GGAAATAATATTTAGCTTACAATAGCTGACATATCTTGCTATTGCGAAGTATCTCAAATG
ATAATAGATTCTTATGATTTTAAAAATAAAACACCTAATTTATACAACTGGATGAAAAGA
ATTGAATAAATACCAGAAATTTAGTAAACCCATTAAATTTTATTCAAACTAGCTCCAAAA
ATGTCATAAAACAAAATAAAACCTAATCTTTGA


>TTHERM_00499550(protein)
MKIFIDWISQPSRAVVTYCLIENIPHEIIQVRVNALEHRKPEYIQINPSAKVPAISDRLE
NGEIFNLFESHAIMRYLADRYNKFKLYPKDNIQLRALINSYLDWHHNNTRKCGAYLFDLY
SSGVLGIKPKNNIETLYKEIEIILKFIDQIWLQEGKNKFIGNNIQLTIADISCYCEVSQM
IIDSYDFKNKTPNLYNWMKRIEQIPEIQQTHQILFKLAPKMSQNKIKPNL