Identifiers and Description

Gene Model Identifier

TTHERM_00499660

Standard Name

EZL3 (Enhancer of Zeste-Like 3)

Aliases

PreTt08009 | 63.m00187 | 3716.m00041

Description

EZL3 SET domain protein; Enhancer of zeste homolog; putative H3K27 HKMT

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09665.1 2.0000012618802033e-84
Description: hypothetical protein (446 aa)
WormBase WBGene00003220 2.999534586690157e-23
Description: locus:mes-2 Histone-lysine N-methyltransferase mes-2 status:Confirmed UniProt:O17514 protein_id:CAB05589.2
Oxytricha Contig14971.0.g38 3.001003044337619e-17
Description: LNS2 (Lipin/Ned1/Smp2)
Stentor Coeruleus SteCoe_9978 0.00000000003775134544279098
Description: None
SGD YJL168C 0.000000030002053728821195
Description: SET2 Histone methyltransferase with a role in transcriptional elongation, methylates a lysine residue of histone H3; associates with the C-terminal domain of Rpo21p; histone methylation activity is regulated by phosphorylation status of Rpo21p
DictyBase DDB_G0268132 0.0000007001298633766835
Description: DDB_G0268132 on chromosome: 1 position 1516724 to 1519586

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25161194: Papazyan R, Voronina E, Chapman JR, Luperchio TR, Gilbert TM, Meier E, Mackintosh SG, Shabanowitz J, Tackett AJ, Reddy KL, Coyne RS, Hunt DF, Liu Y, Taverna SD (2014) Methylation of histone H3K23 blocks DNA damage in pericentric heterochromatin during meiosis. eLife 3( ):e02996
  2. Ref:17575054: Liu Y, Taverna SD, Muratore TL, Shabanowitz J, Hunt DF, Allis CD (2007) RNAi-dependent H3K27 methylation is required for heterochromatin formation and DNA elimination in Tetrahymena. Genes & development 21(12):1530-45

Sequences

>TTHERM_00499660(coding)
ATGTAGTAACCAAACAAAGATACAATATCAGATTTTATAGATTAGAAATAAGAAAAAATT
ATAGAAAAAGTATTAAATATTAGCATAACGTAATAAGAACCTAATGAAAAGTATTTAAAG
TCTATGGAAATCATATAAAAGGCTACATAAAAATTTTTCAATGACCTTTGCTTATAAATT
ATTAGGTTAAGTATTTGGAGTTATAAAATGAGAAGAGTTAGATAAAATAAATGTTTAAAG
TATTAAATTTAAAAGAAAGAATCAATAGCTAAACAATTCTTTAATAACTGGAAGAATAAG
CCTTATCTTAAAAAGAAATAACTCCACATAATTGATAAATCAAATGATGTAATTTAATCT
AACATGTATTCTAATTACATGCCTGTTTCACAAAACGTCTAAACTGATGATTTTTTACTG
TAGCTTTTTCCAGTTATTGAAAGAATTGATTTATACCAAATTGTGAATGAGCTTAAAATG
AAAGAATCTTTATCTGAAAAAAAGAGATTTAAAAAGTGGTTCAAAATTATTAAAAAAATG
AATTTATTAGTTGACATAGAATAAAAGATTTGGATATGGTATATTTACAAGACTTATAAA
AAAACGTTGGGATGCACAAGCTTCATGCAAATTTTTTTTTAATAACCTCAAGTTAAATAA
TAGAATTTTGCTTTAAAATATTTAGATATTAAAAGAATGGTTGAATAGAAAGAATACAAA
TATGGAATTACCATAGAAAAAAAAAATAACGAACACATTGATCCTATCATAGATTTAACT
GCTATGTCTAAGTAATATTACTGCAATATTTGCTATATTTACGATTGCAGGATTCACTTT
TATGAACGAAAAAAAGGTTAAGATTTTTATCATCCAAGCACTTTTGTTCAAAATACTTAA
TAATATTCTGAAAGAATGATTTAATATTTGGTTGATATTTACTAGAAAATGGTTTTTGAT
ATTAATTACTCATTTATGCCAACGTAGGCTGATACATATTGTGGTAAATTTTGCTATAAA
AGGCTTACAAAAGAGAAAATAAAATAAATTAAAGAGAGCTTAAATTATCCTATTTAATTT
TCAGATTTAGATAAGTTATTTATAAAATTAGGGGAATAAAGATTTTATTTTAATATTTGC
TAAATGTCTCTATTGTAATTAAGTTTTAGATGTGATTTGTTATTTATATATTTAGTAGAG
TAGTTTATGCAAAGCTATGAAAGTGAAAATTTTTAGATTTTAAATGACTAGTTTAAATAA
AAATAAGATTAGATATAATTAAAATAAGAATAAAACTTAATGAGTAATTCTATTTTAAAC
TAATCTTCTAATACTCCAAATACTTCTTAATAGAAATTCTAAGTTAAGAAAAACTTTGAT
GATAACGATGACGATGAAGACCCATGGCTTCTTGAAGAAGAAGAAAATGAAAATGAAATT
AATCCTAGTTAATATGAAAATACTCAAAAATAATTAAATTTGGCAGAAAAATTGAAATTG
AAGGTTGAAGAAGATAATAATTAGAATTTTATGCATAAACTAAAAGAGTTTGTGGTTAGC
AACTACACTGTTTAAGAGGTAAATATAAAATAGGAAAAAATAAAATAAGAAAAATTGAAA
GCTCTAATTAGAAAATCTCAATCTTTCTTAGTTAAACCTGAAGTTATGTAAGAAGAATCT
GATGAAGATGAAGGATTATAAAAAGAGAATAATTAACAAAAAAAAGGTGATAAGGAATCA
AAAGAAGATCAAGATGAGTGTTATGGGTATACAAATACCTAAAACGAAACACAATTAGAT
GATAGCTATTAACATTGTGTGCACTATAGGCACAACAGAAAGCCAGTGGACACAAGCTGT
AAAAAATGCTGTTGTAGAAAAAGAGGATTCTGTGATTAATATTGCATGTGTGATCCTAAA
AAATGCAAAATTTATAGGTTTGGATGTAATTGTTAAGACAATTGTTCTAAAAACACATGC
ATATGTTTTAAGAGAAATGTAGAATGTGATCCAGATATATGTAAATCGTGTTTTGAATGC
AAATCTAAATGTAATAACAATCAGATCACACTTAACAAAGTCTAAAGAGTTGTAATAGCT
AATTCAGAAATTTGTGGAGGTCTAGGAATATACAATGTTTATCCTTTGTAAAAAGGAGAT
CTTATAACTATTTATTATGGAGAAGTACTTTAGGATTTAGACATTATAATTAGAGATTCT
TGGAAACCTTCCAATTTATTTTATATTTTTTCTTTATTGGGAGATTTAACAGTTGACTCT
AAATATATTGGAAATAAAAGCAGATTCATGAATCATTCAAAAAGCAAAGAGAATTCTTAT
GCTAAAATGGTCTATGCTAAAGGTGGATACACTATAGGTCTTTTTTCAAATGAAAAAATA
ATACCTGGCACAGAGCTGCTATTTGATTATGATGGACAAGGAACTCTCAAATTAAAATAT
GAATGGATTATGTAAAAGGCAGACTCAAAAGCCAAATAAATTCAAGAAGATAATATAATT
GTGTTTGAAGCTCATAATTCACCTGCTAAAAATTAAAATTTAATAAAATAAAAAAAAAGG
AAATGA


>TTHERM_00499660(gene)
ATGTAGTAACCAAACAAAGATACAATATCAGATTTTATAGATTAGAAATAAGAAAAAATT
ATAGAAAAAGTATTAAATATTAGCATAACGTAATAAGAACCTAATGAAAAGTATTTAAAG
TCTATGGAAATCATATAAAAGGCTACATAAAAATTTTTCAATGACCTTTGCTTATAAGTA
ATTTAAGATTTATTTGGCGCAATAAATTAATCATTTTATTTATAAGATTATTAGGTTAAG
TATTTGGAGTTATAAAATGAGAAGAGTTAGATAAAATAAATGTTTAAAGTATTAAATTTA
AAAGAAAGAATCAATAGCTAAACAATTCTTTAATAACTGGAAGAATAAGCCTTATCTTAA
AAAGAAATAACTCCACATAATTGATAAATCAAATGATGTAATTTAATCTAACATGTATTC
TAATTACATGCCTGTTTCACAAAACGTCTAAGTAAATAATTATAAAGTCAATTTAGATAG
TTATCTTTCATAATTTAAAAAATTAGACTGATGATTTTTTACTGTAGCTTTTTCCAGTTA
TTGAAAGAATTGATTTATACCAAATTGTGAATGAGCTTAAAATGAAAGAATCTTTATCTG
AAAAAAAGAGATTTAAAAAGTGGTTCAAAATTATTAAAAAAATGAATTTATTAGTTGACA
TAGGTATCTTTAAATTTAAAATTAGCTTGGAGTTTTATTATAAATTTTTAAAGAATAAAA
GATTTGGATATGGTATATTTACAAGACTTATAAAAAAACGTTGGGATGCACAAGCTTCAT
GCAAATTTTTTTTTAATAACCTCAAGTTAAATAATAGAATTTTGCTTTAAAGTAAATTTT
TAGCATATTCTTAAATTTTAATGCAATTATTAATTTAGATATTTAGATATTAAAAGAATG
GTTGAATAGAAAGAATACAAGTAAGTATTTAATTTTTGGTATTAAACTTTCATCTATGTC
TTCCTAATTAATTAATATAGATATGGAATTACCATAGAAAAAAAAAATAACGAACACATT
GATCCTATCATAGATTTAACTGCTATGTCTAAGTAATATTACTGCAATATTTGCTATATT
TACGATTGCAGGATTCACTTTTATGAACGAAAAAAAGTAATTAATTTATTTGTAATTTTT
TTAGAGATTTTCTTTGATATTTTTCTATATAAATTTAGAGAGTTTTTAAAAAACTATTTA
AAATTAAGAATAGTTTTTTAAATAATCTTAGAAAATATAGTTAAAGATTTTTTGAATTTT
TATAAGGATATGATTTTACTTTTTTTAATATTTAACTTGAATAGCTTTTTAATCTAATTT
GATTGTGTGTGTATGTTTACAATTTATAATTTAGTAAAAATAATATTTATTTCATATTTA
TATTGAAATGTAATTTAATAGGGTTAAGATTTTTATCATCCAAGCACTTTTGTTCAAAAT
ACTTAATAATATTCTGAAAGAATGATTTAATATTTGGTTGATATTTACTAGAAAATGGTT
TTTGATATTAATTACTCATTTATGCCAACGTAGGCTGATACATATTGTGGTAAATTTTGC
TATAAAAGGCTTACAAAAGAGAAAATAAAATAAGTAAAATTTTAATGAAATAAATATATT
TTTAATATATTTTTTTTTTAGATTAAAGAGAGCTTAAATTATCCTATTTAATTTTCAGAT
TTAGATAAGTTATTTATAAAATTAGGGGAATAAAGATTTTATTTTAATATTTGCTAAATG
TCTCTATTGTAATTAAGTTTTAGATGTGATTTGTTATTTATATATTTAGTAGAGTAGTTT
ATGCAAAGCTATGAAAGTGAAAATTTTTAGATTTTAAATGACTAGTTTAAATAAAAATAA
GATTAGATATAATTAAAATAAGAATAAAACTTAATGAGTAATTCTATTTTAAACTAATCT
TCTAATACTCCAAATACTTCTTAATAGAAATTCTAAGTTAAGAAAAACTTTGATGATAAC
GATGACGATGAAGACCCATGGCTTCTTGAAGAAGAAGAAAATGAAAATGAAATTAATCCT
AGTTAATATGAAAATACTCAAAAATAATTAAATTTGGCAGAAAAATTGAAATTGAAGGTT
GAAGAAGATAATAATTAGAATTTTATGCATAAACTAAAAGAGTTTGTGGTTAGCAACTAC
ACTGTTTAAGAGGTAAATATAAAATAGGAAAAAATAAAATAAGAAAAATTGAAAGCTCTA
ATTAGAAAATCTCAATCTTTCTTAGTTAAACCTGAAGTTATGTAAGAAGAATCTGATGAA
GATGAAGGATTATAAAAAGAGAATAATTAACAAAAAAAAGGTGATAAGGAATCAAAAGAA
GATCAAGATGAGTGTTATGGGTATACAAATACCTAAAACGAAACACAATTAGATGATAGC
TATTAACATTGTGTGCACTATAGGCACAACAGAAAGCCAGTGGACACAAGCTGTAAAAAA
TGCTGGTAAATTTAATTTACAATTTATTTTAAAATAGTGATTGTGAATAATTAATTAAAA
TTAAAGTTGTAGAAAAAGAGGATTCTGTGATTAATATTGCATGTGTGATCCTAAAAAATG
CAAAATTTATAGGTTTGGATGTAATTGTTAAGACAATTGTTCTAAAAACACATGCATATG
TTTTAAGAGAAATGTAGAATGTGATCCAGATGTAAAATAGCTTTTATAATAACATTAATA
TAAAATTCAACTATTTTTTAAGATATGTAAATCGTGTTTTGAATGCAAATCTAAATGTAA
TAACAATCAGATCACACTTAACAAAGTCTAAGTAATAATTATATTTTTTATTTTGATTTA
ATTATTTTGATTTTTTTTTCTATTTAATTTAAGAGAGTTGTAATAGCTAATTCAGAAATT
TGTGGAGGTCTAGGAATATACAATGTTTATCCTTTGTAAAAAGGAGATCTTATAACTATT
TATTATGGAGAAGTACTTTAGGATTTAGACATTATAATTAGAGATTCTTGGAAACCTTCC
AATTTATTTTATATTTTTTCTTTATTGGGAGATTTAACAGTTGACTCTAAATATATTGGA
AATAAAGTAAGATTGAACAAAAAATTGTTTACAAAAATATTTATTTTTTCTATTTTTCTT
TACACTAATAAAGAGCAGATTCATGAATCATTCAAAAAGCAAAGAGAATTCTTATGCTAA
AATGGTCTATGCTAAAGGTGGATACACTATAGGTCTTTTTTCAAATGAAAAAATAATACC
TGGCACAGAGCTGCTATTTGATTATGATGGACAAGGAACTCTCAAATTAAAATATGAATG
GATTATGTAAAAGGCAGACTCAAAAGCCAAATAAATTCAAGAAGATAATATAATTGTGTT
TGAAGCTCATAATTCACCTGCTAAAAATTAAAATTTAATAAAATAAAAAAAAAGGAAATG
A


>TTHERM_00499660(protein)
MQQPNKDTISDFIDQKQEKIIEKVLNISITQQEPNEKYLKSMEIIQKATQKFFNDLCLQI
IRLSIWSYKMRRVRQNKCLKYQIQKKESIAKQFFNNWKNKPYLKKKQLHIIDKSNDVIQS
NMYSNYMPVSQNVQTDDFLLQLFPVIERIDLYQIVNELKMKESLSEKKRFKKWFKIIKKM
NLLVDIEQKIWIWYIYKTYKKTLGCTSFMQIFFQQPQVKQQNFALKYLDIKRMVEQKEYK
YGITIEKKNNEHIDPIIDLTAMSKQYYCNICYIYDCRIHFYERKKGQDFYHPSTFVQNTQ
QYSERMIQYLVDIYQKMVFDINYSFMPTQADTYCGKFCYKRLTKEKIKQIKESLNYPIQF
SDLDKLFIKLGEQRFYFNICQMSLLQLSFRCDLLFIYLVEQFMQSYESENFQILNDQFKQ
KQDQIQLKQEQNLMSNSILNQSSNTPNTSQQKFQVKKNFDDNDDDEDPWLLEEEENENEI
NPSQYENTQKQLNLAEKLKLKVEEDNNQNFMHKLKEFVVSNYTVQEVNIKQEKIKQEKLK
ALIRKSQSFLVKPEVMQEESDEDEGLQKENNQQKKGDKESKEDQDECYGYTNTQNETQLD
DSYQHCVHYRHNRKPVDTSCKKCCCRKRGFCDQYCMCDPKKCKIYRFGCNCQDNCSKNTC
ICFKRNVECDPDICKSCFECKSKCNNNQITLNKVQRVVIANSEICGGLGIYNVYPLQKGD
LITIYYGEVLQDLDIIIRDSWKPSNLFYIFSLLGDLTVDSKYIGNKSRFMNHSKSKENSY
AKMVYAKGGYTIGLFSNEKIIPGTELLFDYDGQGTLKLKYEWIMQKADSKAKQIQEDNII
VFEAHNSPAKNQNLIKQKKRK