Identifiers and Description

Gene Model Identifier

TTHERM_00503901

Standard Name

TWI3 (Tetrahymena piWI 3)

Aliases

3723.m00722

Description

twi2p; piwi-like Twi9p protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14909.1 9.997093137033517e-262
Description: piwi domain-containing protein (808 aa)
Oxytricha Contig16116.0.g20 2.0001925730668994e-91
Description: Piwi domain
DictyBase DDB_G0276299 2.9997879492220375e-71
Description: agnA on chromosome: 2 position 6579134 to 6582276
WormBase WBGene00004178 1.0002012508493003e-67
Description: locus:prg-1 status:Confirmed UniProt:P90786 protein_id:CAA98113.1
Stentor Coeruleus SteCoe_1846 3.0144087850653746e-40
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:19656801: Couvillion MT, Lee SR, Hogstad B, Malone CD, Tonkin LA, Sachidanandam R, Hannon GJ, Collins K (2009) Sequence, biogenesis, and function of diverse small RNA classes bound to the Piwi family proteins of Tetrahymena thermophila. Genes & development 23(17):2016-32

Sequences

>TTHERM_00503901(coding)
ATGCTTTAATAGTTACCTAAAAGGCCACCTAAATCTTCATCCTAAGAGATTAGCAAAATA
TGCAGAAATATTAAACTACTGACAAATCTGTTTACTATGTAAGTAGAAGCCCCTTAGTCT
TCTGATTCTGATGGACCTCAAGGTTGTGTCTACAAACTTCTTTGTTATCAATATGATGTT
GAATTCTCTCCTAATATTGCTGAGGACAACAGAAACCTCAGATACAAAATCTTTAAAGAA
GCTCGCAGAGATATTGAGCAAATCATAGGAAAATTCTCCTTTTCAGGAAAATCTCTATTC
TCAATGAAAAATCTTAGCATAGTTAAGCTTAACAAAATCAAGAATATTGATGCGATCAAT
GTTGATGGATAAAAATACTCTATCCTTTTGAGGTTCACAAAAAGCTTTGAAGTGAATGAT
GAGTCTGCTTAAAATAAAGATAAGACGTCTGTAAACTTCAAAAAAGGCAATCAAGTCACT
TAGTTGCTCAATATCATCTTAAAGTCTATTATGCGTGATGAGAAATTCTAGGAAATTGGA
AAGAATTCTAAGTTCTATGATGTTAACTCTAAGAGTGATATTATAATCAAAAGTAGAGAT
GGATCTACTAGTGCCCTAGAAGCCTACAAAGGATTCACTTTCAATGTCACTCCAACCTAA
GACAGACTTTACTTAATGGTTGATTACTGCAGTAGAATTATCAGAAAAGAAACTGCATTA
GAATACTTAAAGAATAATAACAATTAATTGTCTGGTCTTTCAGTAATTACCAAATACAAT
AATTATCAAACTTACTTAATCGACAGAGTAGATGACAAAAAAACTCCTAGTTCTACTTTC
CTTAACTAAAAAACTAAAACCTAAATTAGTTTCGCATAATACTACAAGGAGCGTTATAAT
ATCTAAATCAGAGACATGAAATAGCCCTTACTTGTTCATAAAAGAAAATACAGAGAGCCT
AATACTAACATCTAAAAGATTGAAGAAGTTTATTTAATTCCTGAATTATGCAATATGACA
GGAATGACAGACGAATAACGTGAAAATTTTCAAGCAATGAAGGAAGTTGCTACTCATACA
AAACTTACTCCAAATGAAAGATATCAAAATTCTGTTAAAAATTGCAAATTTTTAAGTAAC
AAAACAAGTTCCAGTGGAATTAAAATTGATGAAAAAAGCAATTTGATAGATGCTGTTTAA
TTAAGAGCTCCTAAAGTCACTTTAGGTGGTAATAAGACAGCTAATACAGAAAGAGGTAAT
TTTGACATGAGAGCTCCTACCTTAGATAAAATTGAGTTTAAAGATTGGTCTCTTATATGT
AACAAAAAAGATGACTAAAGTGCAGATAATTTTATAGACACTCTTAAGAAGGCTTCCTAG
ACATTTGGAATTACTGTCAACGATCCTTGCTTTTTGGCCTAGAGAGACTGGAATGCTAAT
AACTGGATTAAAACTCTCGATGAAGACTTTTCCAATAATGGTTTACCTCAATTTGTTTTG
AGTTTCGGTCAAGCCAATAGTGGTTTATACTCTGGTTTAAAGAGATTTTTAACTTCAGAA
GTAGGTATAGAATCCTAGCATGTTAATCCAAGATCCCTCCAAAAGAACGGAATGAGTGTT
GCTTCAAAAATTGCTCTGCAAATTGCCTCTAAACTAGGTAGAAGAATCTGGTAAGTTGAA
ACCCCAACTGGAATTGATAAAAACACCATGATTATCGGTATAGAGACCAGTATGAAGAAG
ATCAATAAATAATAGGTGATTGGTGTTGTAGCTTCCATCGACAAAGACTTTACCAAATAC
TTTTCTGATGTTGAAATTAGGAAAGAAAATGATACTACTTTCCCTACTCTCTCTAAGATT
GTTACTAAAGCCATATAAGCTTATATTAAAAATACCAAAGTTGTTCCTGCTGAAGTGATT
GTTTACAGATAAGGGCTTGGTGAAGGTTAAATTCAATAGAGTTGTAACTTTGAAATTAAG
GCCATTTAGAATGGTTTTAGCAACTTTAAGAAAGATTACAATCCACGCTTAGCCTTTTTC
TAGGTTAACAGAAAAATTGGCCAAAAGTTCTATCAATAGCCTTAAGGTGACAAATCAGAA
GTTTCAAATCCTGCTTCAGGTACTATTGTAGCCTCTTAAGTTGTTTAGAACAACTTTGAA
TTCTTCATGGCTGCATAAAACTGTAATTCTGGTGTTTGTACACCCACTAAGTACACTTGT
TTGTACAACAACACCAACTTAAAAGAGGATCAAATCTGGTAATTAACTTATTATCAAACA
TTCAACTATTATAACTGGCAAGGACCTGTAAGAGTACCTGCTGCTATGAAGTACGCAGAA
AAACTTGCTAAGTTTGTTAGTGACACTATCCAAGAATCTGCCAATGAAAACTTGGCTAAC
AGTCTTTTCTATTTGTGA


>TTHERM_00503901(gene)
ATGCTTTAATAGTTACCTAAAAGGCCACCTAAATCTTCATCCTAAGAGATTAGCAAAATA
TGCAGAAATATTAAACTACTGACAAATCTGTTTACTATGTAAGTAGAAGCCCCTTAGTCT
TCTGATTCTGATGGACCTCAAGGTTGTGTCTACAAACTTCTTTGTTATCAATATGATGTT
GAATTCTCTCCTAATATTGCTGAGGACAACAGAAACCTCAGATACAAAATCTTTAAAGAA
GCTCGCAGAGATATTGAGCAAATCATAGGAAAATTCTCCTTTTCAGGAAAATCTCTATTC
TCAATGAAAAATCTTAGCATAGTTAAGCTTAACAAAATCAAGAATATTGATGCGATCAAT
GTTGATGGATAAAAATACTCTATCCTTTTGAGGTTCACAAAAAGCTTTGAAGTGAATGAT
GAGTCTGCTTAAAATAAAGATAAGACGTCTGTAAACTTCAAAAAAGGCAATCAAGTCACT
TAGTTGCTCAATATCATCTTAAAGTCTATTATGCGTGATGAGAAATTCTAGGAAATTGGA
AAGAATTCTAAGTTCTATGATGTTAACTCTAAGAGTGATATTATAATCAAAAGTAGAGAT
GGATCTACTAGTGCCCTAGAAGCCTACAAAGGATTCACTTTCAATGTCACTCCAACCTAA
GACAGACTTTACTTAATGGTTGATTACTGCAGTAGAATTATCAGAAAAGAAACTGCATTA
GAATACTTAAAGAATAATAACAATTAATTGTCTGGTCTTTCAGTAATTACCAAATACAAT
AATTATCAAACTTACTTAATCGACAGAGTAGATGACAAAAAAACTCCTAGTTCTACTTTC
CTTAACTAAAAAACTAAAACCTAAATTAGTTTCGCATAATACTACAAGGAGCGTTATAAT
ATCTAAATCAGAGACATGAAATAGCCCTTACTTGTTCATAAAAGAAAATACAGAGAGCCT
AATACTAACATCTAAAAGATTGAAGAAGTTTATTTAATTCCTGAATTATGCAATATGACA
GGAATGACAGACGAATAACGTGAAAATTTTCAAGCAATGAAGGAAGTTGCTACTCATACA
AAACTTACTCCAAATGAAAGATATCAAAATTCTGTTAAAAATTGCAAATTTTTAAGTAAC
AAAACAAGTTCCAGTGGAATTAAAATTGATGAAAAAAGCAATTTGATAGATGCTGTTTAA
TTAAGAGCTCCTAAAGTCACTTTAGGTGGTAATAAGACAGCTAATACAGAAAGAGGTAAT
TTTGACATGAGAGCTCCTACCTTAGATAAAATTGAGTTTAAAGATTGGTCTCTTATATGT
AACAAAAAAGATGACTAAAGTGCAGATAATTTTATAGACACTCTTAAGAAGGCTTCCTAG
ACATTTGGAATTACTGTCAACGATCCTTGCTTTTTGGCCTAGAGAGACTGGAATGCTAAT
AACTGGATTAAAACTCTCGATGAAGACTTTTCCAATAATGGTTTACCTCAATTTGTTTTG
AGTTTCGGTCAAGCCAATAGTGGTTTATACTCTGGTTTAAAGAGATTTTTAACTTCAGAA
GTAGGTATAGAATCCTAGCATGTTAATCCAAGATCCCTCCAAAAGAACGGAATGAGTGTT
GCTTCAAAAATTGCTCTGCAAATTGCCTCTAAACTAGGTAGAAGAATCTGGTAAGTTGAA
ACCCCAACTGGAATTGATAAAAACACCATGATTATCGGTATAGAGACCAGTATGAAGAAG
ATCAATAAATAATAGGTGATTGGTGTTGTAGCTTCCATCGACAAAGACTTTACCAAATAC
TTTTCTGATGTTGAAATTAGGAAAGAAAATGATACTACTTTCCCTACTCTCTCTAAGATT
GTTACTAAAGCCATATAAGCTTATATTAAAAATACCAAAGTTGTTCCTGCTGAAGTGATT
GTTTACAGATAAGGGCTTGGTGAAGGTTAAATTCAATAGAGTTGTAACTTTGAAATTAAG
GCCATTTAGAATGGTTTTAGCAACTTTAAGAAAGATTACAATCCACGCTTAGCCTTTTTC
TAGGTTAACAGAAAAATTGGCCAAAAGTTCTATCAATAGCCTTAAGGTGACAAATCAGAA
GTTTCAAATCCTGCTTCAGGTACTATTGTAGCCTCTTAAGTTGTTTAGAACAACTTTGAA
TTCTTCATGGCTGCATAAAACTGTAATTCTGGTGTTTGTACACCCACTAAGTACACTTGT
TTGTACAACAACACCAACTTAAAAGAGGATCAAATCTGGTAATTAACTTATTATCAAACA
TTCAACTATTATAACTGGCAAGGACCTGTAAGAGTACCTGCTGCTATGAAGTACGCAGAA
AAACTTGCTAAGTTTGTTAGTGACACTATCCAAGAATCTGCCAATGAAAACTTGGCTAAC
AGTCTTTTCTATTTGTGA


>TTHERM_00503901(protein)
MLQQLPKRPPKSSSQEISKICRNIKLLTNLFTMQVEAPQSSDSDGPQGCVYKLLCYQYDV
EFSPNIAEDNRNLRYKIFKEARRDIEQIIGKFSFSGKSLFSMKNLSIVKLNKIKNIDAIN
VDGQKYSILLRFTKSFEVNDESAQNKDKTSVNFKKGNQVTQLLNIILKSIMRDEKFQEIG
KNSKFYDVNSKSDIIIKSRDGSTSALEAYKGFTFNVTPTQDRLYLMVDYCSRIIRKETAL
EYLKNNNNQLSGLSVITKYNNYQTYLIDRVDDKKTPSSTFLNQKTKTQISFAQYYKERYN
IQIRDMKQPLLVHKRKYREPNTNIQKIEEVYLIPELCNMTGMTDEQRENFQAMKEVATHT
KLTPNERYQNSVKNCKFLSNKTSSSGIKIDEKSNLIDAVQLRAPKVTLGGNKTANTERGN
FDMRAPTLDKIEFKDWSLICNKKDDQSADNFIDTLKKASQTFGITVNDPCFLAQRDWNAN
NWIKTLDEDFSNNGLPQFVLSFGQANSGLYSGLKRFLTSEVGIESQHVNPRSLQKNGMSV
ASKIALQIASKLGRRIWQVETPTGIDKNTMIIGIETSMKKINKQQVIGVVASIDKDFTKY
FSDVEIRKENDTTFPTLSKIVTKAIQAYIKNTKVVPAEVIVYRQGLGEGQIQQSCNFEIK
AIQNGFSNFKKDYNPRLAFFQVNRKIGQKFYQQPQGDKSEVSNPASGTIVASQVVQNNFE
FFMAAQNCNSGVCTPTKYTCLYNNTNLKEDQIWQLTYYQTFNYYNWQGPVRVPAAMKYAE
KLAKFVSDTIQESANENLANSLFYL