Identifiers and Description

Gene Model Identifier

TTHERM_00516440

Standard Name

GST27 (Glutathione S-transferase mu 27, TtGSTm27, GSTm27)

Aliases

PreTt10736 | 64.m00216 | 3723.m00072

Description

GST27 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain
  • ( PF06445 ) Bacterial transcription activator, effector binding

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_15445.1 1.0002434920975502e-91
Description: glutathione S-transferase Mu (216 aa)
Oxytricha Contig12816.0.g91 1.9994498063102785e-22
Description: Glutathione S-transferase, N-terminal domain
WormBase WBGene00001782 0.00000019998969434520019
Description: locus:gst-34 status:Partially_confirmed UniProt:Q86S58 protein_id:CCD73729.1
DictyBase DDB_G0274081 0.00000030014504373857585
Description: DDB_G0274081 on chromosome: 2 position 3748941 to 3749724

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00516440(coding)
ATGATAATCCTTGGTTACTGGAATCTAAGAGGCTACGCTTAACCTATTCGTCTCCTTCTA
GAATATTTGTAAGTAGATTATAAGGAAAAACTTTATAACTAAGATGGAGAAGAATGGTTA
AATGTTGATAAATAATAACTTAAAACTAATTTCCCTAACTTACCTTATATAATTGATGGA
GATATTGTTGTAACAGAATCAAAAGTTATTCCTATTTACTTGGCCAAGAAATTCAAAAAT
TATGAGCTTATTGGCTAAAATCCTGATGGGTCTTTTAATTTGAATGAAATTACATTCCTT
TAAATCTTAGAAATTTTGAAAGAACTCAGAGATTCGTTATTGAATTCAGCAAAAGTACCA
TCTTTCAAAGAAGAAAAAGATTAAATTTTCAATGAAAAATTCAACATTACTTTTGAGAAA
ATAAAGAAACAACTTGGAGAGAACAAATACCTGCTTGGAAATCTTTCATTTATAGATTTC
TATTTTTATGAAGTTTTGAAATTTTTCTAATTCTTTTATCCAAAACTTTCAATCTTTACC
GACTATATTGATAGAATAGAAAATATTCCTCAAATAAAAAACTATCTTGAAACAAAAGAA
AACAAAATCTTTATTCTTGATAGAATGAAAAGCTATTTTTATTATTGA


>TTHERM_00516440(gene)
ATGATAATCCTTGGTTACTGGAATCTAAGAGGCTACGCTTAACCTATTCGTCTCCTTCTA
GAATATTTGTAAGTAGATTATAAGGAAAAACTTTATAACTAAGATGGAGAAGAATGGTTA
AATGTTGATAAATAATAACTTAAAACTAATTTCCCTAACTTACCTTATATAATTGATGGA
GATATTGTTGTAACAGAATCAAAAGTTATTCCTATTTACTTGGCCAAGAAATTCAAAAAT
TATGAGCTTATTGGCTAAAATCCTGATGGGTCTTTTAATTTGAATGAAATTACATTCCTT
TAAATCTTAGAAATTTTGAAAGAACTCAGAGATTCGTTATTGAATTCAGCAAAAGTACCA
TCTTTCAAAGAAGAAAAAGATTAAATTTTCAATGAAAAATTCAACATTACTTTTGAGGTA
TTTGAATACAATTTTTTTAATTTACTAAATATTTAATTATTATTATAAACATAGAAAATA
AAGAAACAACTTGGAGAGAACAAATACCTGCTTGGAAATCTTTCATTTATAGATTTCTAT
TTTTATGAAGTTTTGAAATTTTTCTAATTCTTTTATCCAAAACTTTCAATCTTTACCGAC
TATATTGATAGAATAGAAAATATTCCTCAAATAAAAAACTATCTTGAAACAAAAGAAAAC
AAAATCTTTATTCTTGATAGAATGAAAAGCTATTTTTATTATTGA


>TTHERM_00516440(protein)
MIILGYWNLRGYAQPIRLLLEYLQVDYKEKLYNQDGEEWLNVDKQQLKTNFPNLPYIIDG
DIVVTESKVIPIYLAKKFKNYELIGQNPDGSFNLNEITFLQILEILKELRDSLLNSAKVP
SFKEEKDQIFNEKFNITFEKIKKQLGENKYLLGNLSFIDFYFYEVLKFFQFFYPKLSIFT
DYIDRIENIPQIKNYLETKENKIFILDRMKSYFYY