Identifiers and Description

Gene Model Identifier

TTHERM_00522110

Standard Name

MRNO15 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt12326 | 65.m00144 | 3717.m00023

Description

MORN motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12897.1 5.001736064328732e-162
Description: hypothetical protein (390 aa)
Oxytricha Contig13677.0.1.g35 8.997498379799854e-17
Description: MORN repeat
DictyBase DDB_G0349488 0.0000000039998859049333245
Description: DDB_G0349488 on chromosome: 2 position 6912714 to 6914186
WormBase WBGene00002179 0.0007999190683310628
Description: locus:jph-1 status:Confirmed UniProt:Q22667 protein_id:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00522110(coding)
ATGATAGATTTAAGTTTAAGCTAAGTTGATTTTGAGGATTAGAAATTAAGCAACTTAATT
TGTTAGTATCATAAAAGAAAGGTTACCGCATTTTGTATCCAACAAGATTGCCATTAAAAT
GATAGATTTGCATGTTTTTAATGCTTATCTAGCAGGGAGCATTCTAATCATTAGTTCATT
GACTCTGAAGATGTCGTTTCTATTTTGAAGCAAGGTCTCCCAAGTTTTAAAAATTAAATT
ATATAAAACTTTGAACAACTCAGCAAGAGCATTGTATCTTTGTTTTAAAACAAAGTAAAG
AATTTTATTAATTAAAAAGCAGATACATTTGCATAGCGTTTTGAGCGTTGCTTCTCATTA
AATATTTCTGAAAGAGATTAGAAACTCTCTGAATAATTGCTTGAGTTATACAAATTAATA
TACAAGTAAAATGGGAATTATTTATTAGATATTTGCTAAAGCATGGGTTAAACTCTATAT
TCCTCTATATAAAAATAACTTGAAACAATAATGAAAAAAATAAATGATTATGAATTTGAT
AAAGAACTTTAAAGATTTGAAATAGAAAACTAGGTAATTCATAATCTTACTAAAGAAGCA
TTAGAAGCTTATTAGAAATACAAAAATGAAAATATTTTTGATGATCTAAATAAAGAAAAT
AATAATGACTCAAGGCTTTATTTGGTAAACGATAGAGACTTTTATACTGTATCTTAATTT
AACATAGAAGGATAAAGGCATGGTAGAACAATTGAAATTCCTTCTTAAGGCCATTATTTT
AAAGGTTATTTAAGCAATGGTTTAAGAAACGGAAAAGGGCTCTATATTTATTAGGATGGT
ACAGTATATTTAGGGATTTTTAAAAATAATTAAAAAGATGGTAGTGGTAAGTTAATAAAT
CGAGATGGCTACATTTATAGCGGAGAATGGAAGGAAGATTAAAAGAATGGGGTAGGAGAA
GAAAAATTTAACGATGACTGGGTTTTTGAAGGGTTCTTTGAAAATAATTAAAGAAATGGG
CCAGGTTAAGAAACAAATAAAAAATTAGGTTTAGTTATTCAAGCAATATATGAGAAAGGC
GAGATAGTTAACACTATTTCATAATTATAAATATAATAATAGTTATAACAACCATAGTGA


>TTHERM_00522110(gene)
ATGATAGATTTAAGTTTAAGCTAAGTTGATTTTGAGGATTAGAAATTAAGCAACTTAATT
TGTTAGTATCATAAAAGAAAGGTTACCGCATTTTGTATCCAACAAGATTGCCATTAAAAT
GATAGATTTGCATGTTTTTAATGCTTATCTAGCAGGGAGCATTCTAATCATTAGTTCATT
GACTCTGAAGATGTCGTTTCTATTTTGAAGCAAGGTCTCCCAAGTTTTAAAAATTAAATT
ATATAAAACTTTGAACAACTCAGCAAGAGCATTGTATCTTTGTTTTAAAACAAAGTAAAG
AATTTTATTAATTAAAAAGCAGATACATTTGCATAGCGTTTTGAGCGTTGCTTCTCATTA
AATATTTCTGAAAGAGATTAGAAACTCTCTGAATAATTGCTTGAGTTATACAAATTAATA
TACAAGTAAAATGGGAATTATTTATTAGATATTTGCTAAAGCATGGGTTAAACTCTATAT
TCCTCTATATAAAAATAACTTGAAACAATAATGAAAAAAATAAATGATTATGAATTTGAT
AAAGAACTTTAAAGATTTGAAATAGAAAACTAGGTAATTCATAATCTTACTAAAGAAGCA
TTAGAAGCTTATTAGAAATACAAAAATGAAAATATTTTTGATGATCTAAATAAAGAAAAT
AATAATGACTCAAGGCTTTATTTGGTAAACGATAGAGACTTTTATACTGTATCTTAATTT
AACATAGAAGGATAAAGGCATGGTAGAACAATTGAAATTCCTTCTTAAGGCCATTATTTT
AAAGGTTATTTAAGCAATGGTTTAAGAAACGGAAAAGGGCTCTATATTTATTAGGATGGT
ACAGTATATTTAGGGATTTTTAAAAATAATTAAAAAGATGGTAGTGGTAAGTTAATAAAT
CGAGATGGCTACATTTATAGCGGAGAATGGAAGGAAGATTAAAAGAATGGGGTAGGAGAA
GAAAAATTTAACGATGACTGGGTTTTTGAAGGGTTCTTTGAAAATAATTAAAGAAATGGG
CCAGGTTAAGAAACAAATAAAAAATTAGGTTTAGTTATTCAAGCAATATATGAGAAAGGC
GAGATAGTTAACACTATTTCATAATTATAAATATAATAATAGTTATAACAACCATAGTGA


>TTHERM_00522110(protein)
MIDLSLSQVDFEDQKLSNLICQYHKRKVTAFCIQQDCHQNDRFACFQCLSSREHSNHQFI
DSEDVVSILKQGLPSFKNQIIQNFEQLSKSIVSLFQNKVKNFINQKADTFAQRFERCFSL
NISERDQKLSEQLLELYKLIYKQNGNYLLDICQSMGQTLYSSIQKQLETIMKKINDYEFD
KELQRFEIENQVIHNLTKEALEAYQKYKNENIFDDLNKENNNDSRLYLVNDRDFYTVSQF
NIEGQRHGRTIEIPSQGHYFKGYLSNGLRNGKGLYIYQDGTVYLGIFKNNQKDGSGKLIN
RDGYIYSGEWKEDQKNGVGEEKFNDDWVFEGFFENNQRNGPGQETNKKLGLVIQAIYEKG
EIVNTISQLQIQQQLQQPQ