Identifiers and Description

Gene Model Identifier

TTHERM_00522490

Standard Name

ATG8 (AuTophaGy related 8)

Aliases

PreTt12364 | 65.m00182 | 3717.m00061

Description

ATG8 autophagy protein Atg8 ubiquitin-like protein; Ubiquitin-like protein whose conjugation target is phosphatidylethanolamine (PE); required for formation of autophagosomes; Atg8p-PE is anchored to membranes; one of two ATG8 genes in Tetrahymena (see TTHERM_00037460)

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02991 ) Microtubule associated protein 1A/1B, light
  • ( PF04110 ) Autophagy protein Apg12

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12857.1 3.9983507938127826e-75
Description: hypothetical protein (123 aa)
Oxytricha Contig22034.0.g103 3.998693556225637e-29
Description: Autophagy protein Atg8 ubiquitin like
WormBase WBGene00002980 8.000124778438792e-23
Description: locus:lgg-1 Protein lgg-1 status:Confirmed UniProt:Q09490 protein_id:CCD66037.1
DictyBase DDB_G0286191 3.0002687256732656e-20
Description: atg8 on chromosome: 4 position 4321108 to 4321704
SGD YBL078C 1.9999391735788327e-19
Description: ATG8 Component of autophagosomes and Cvt vesicles; undergoes conjugation to phosphatidylethanolamine (PE); Atg8p-PE is anchored to membranes, is involved in phagophore expansion, and may mediate membrane fusion during autophagosome formation
Stentor Coeruleus SteCoe_19415 0.0000000000006914400106940203
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00522490(coding)
ATGGACTCAAATAAACGTTATAAAGATCTTCTTAGTGAAGATTAAAGAAAATCAGAATGC
GAAAATATAAGAAAGAATTATCCTGATAAGATTCCCCTCATTATTGAGAAGCATCCTAAA
TCTAAATTAGAATAAATAGATAGGACAAAATTCTTAATTCTTGAAAAGCTTAGAGTTTAT
CAAGTAAACACAATTATACGTAGAAAAATGAGTCTCAATAAAGTAGATGCTCTCTATCTC
TTTGTTAATGATAATATTCTTTTAAGAGGAGATTAATGCTTAAAAGATGTTTATGAAAAA
TACAAAGATTCAGATGGATTTATTTATCTTTCTTACTGCGAATATAGTTCTTTTGGTAAG
AATATCTGA


>TTHERM_00522490(gene)
ATGGACTCAAATAAACGTTATAAAGATCTTCTTAGTGAAGATTAAAGAAAATCAGAATGC
GAAAATATAAGAAAGAATTATCCTGATAAGATTCCCCTCATTATTGAGAAGCATCCTAAA
TCTAAATTAGAATAAATAGATAGGACAAAGTAAAATATTTTTTAAGTTCCAATTCAATTA
TGCGGTTAGCTAAATTAAAATACATATTTAACAAAAATTTATTTGATGGAGTATTAATAG
CTCTATTTTATAATAATTGTATTAAAGTGCACATAATTTGAAGTTTCATTTTAGCAATTT
AGAAAATTATTTGGATATAAATTGGATTAATTTATTTTTTAACATTTTAAATAGATTCTT
AATTCTTGAAAAGCTTAGAGTTTATCAAGTAAACACAATTATACGTAGAAAAATGAGTCT
CAATAAAGTAGATGCTCTCTATCTCTTTGTTAATGATAATATTCTTTTAAGAGGAGGTAT
TTCATAAACTTAAATAATATAAATATAAGATTATTAGATTTTTTTAAAGAATCAAATTTA
TTAATGATTTTATTATATCCATAATTTCAATTTTTCTTAAATAAAATATGGTTTAAAGAT
AAATAATTTTAACAATAGATTAATGCTTAAAAGATGTTTATGAAAAATACAAAGATTCAG
ATGGATTTATTTATCTTTCTTACTGCGAATATAGTTCTTTTGGTAAGAATATCTGA


>TTHERM_00522490(protein)
MDSNKRYKDLLSEDQRKSECENIRKNYPDKIPLIIEKHPKSKLEQIDRTKFLILEKLRVY
QVNTIIRRKMSLNKVDALYLFVNDNILLRGDQCLKDVYEKYKDSDGFIYLSYCEYSSFGK
NI