Identifiers and Description

Gene Model Identifier

TTHERM_00522630

Standard Name

RPS0 (Ribosomal Protein of the Small subunit #0)

Aliases

PreTt12378 | 65.m00196 | 3717.m00075

Description

RPS0 40S ribosomal protein S0; Homolog of yeast RPS0- human RPSA- bacteria RPS2

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12843.1 9.996894623038854e-156
Description: ribosomal protein S2 containing protein (242 aa)
SGD YGR214W 9.997863464222902e-69
Description: RPS0A Protein component of the small (40S) ribosomal subunit, nearly identical to Rps0Bp; required for maturation of 18S rRNA along with Rps0Bp; deletion of either RPS0 gene reduces growth rate, deletion of both genes is lethal
Oxytricha Contig845.1.g5 2.000597631390999e-64
Description: Ribosomal protein S2
DictyBase DDB_G0270316 2.998990600740728e-62
Description: rpsA on chromosome: 1 position 4628419 to 4629156
WormBase WBGene00004469 9.999353957415832e-59
Description: locus:rps-0 40S ribosomal protein SA status:Confirmed UniProt:P46769 protein_id:CAA86061.1
Stentor Coeruleus SteCoe_28184 2.4426007377405277e-36
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00522630(coding)
ATGGCCACTCAAAGAAAACAAGACGATATCAAGAGACTTTTGGCTTCCAACTGCCACTAA
GCTACCATTAACCTCAACAACCAAATGAAGAGATACATCTCTCACAAGGGCGTCAACGGT
ATTCATTACATCAATATTGAAGAAACCTGGTAAAAGATCAAGCTCGCTGCTAGAGTTATT
GCCGCCGTTCAACACCCCGAAGATGTTATGGTTGTTTGCTCTAGAATTTACGGTCAAAGA
GCTGCCATCAAGTTCGCTGGTTACACTCACTGCAAGTCTACCTCTTCTTCCAGATGGACT
CCTGGTACCTTGACCAATTACTAGACCTTAAAATACGAAGAACCCAGAGTTCTCATCGTC
ACTGATCCCAGATCTGACTTCTAAGCCATTAAGGAAGCTTCTTATGTCAACATTCCCGTT
ATTGCTTTGTGCGACTCTGACTCTCCTCTCGCCTACGTCGATGTTGTCATTCCTTGCAAC
AACAGATCCACCGAATCTATCTCCATGATCTACTGGATGATCGCCAGAGAAGTTAAAATC
CTCAGAGGTGAACTCTCTAAGGACGAAGAATGGGAAGTTATGGTTGATCTCTTCTACCAC
AAGACCCTCCCCACTGCTGAACAAAAGGAAGCTGAAGAAGAAGAAGGTGCTGAAGGTGCT
GAAGAAAAGGTCGCTGAAGTTAAGGAAGGTGAAGCTGAACAAAATACTGATAACAAAAAC
TGGTGA


>TTHERM_00522630(gene)
ATGGCCACTCAAAGAAAACAAGACGATATCAAGAGACTTTTGGCTTCCAACGTATTAAAG
CATTAAAATAATTGAAATTCTATTACAAAAAATAGACTAATTTTTTGGGAAACCTCCTCA
TTAGCATCCATTTTTGCATGCGAGGACAGATCTTTCTTCCCAATAACTAATTATTTGCAG
AGTTAAATTTAATATATTCATTTTCATAATGTGTTGTTAATGATATAAAATATAGTGCCA
CTAAGCTACCATTAACCTCAACAACCAAATGAAGAGATACATCTCTCACAAGGGCGTCAA
CGGTATTCATTACATCAATATTGAAGAAACCTGGTAAAAGATCAAGCTCGCTGCTAGAGT
TATTGCCGCCGTTCAACACCCCGAAGATGTTATGGTAAGAATATTTAATCTTTTGAATGT
TTATTTTCTTATGCAAGCAAGAATCACAGTTATTGTAAGTAATGCTCTCACCATATAACA
TTTACAAAAGCAAAATGAATGCAATAGTGAGTTTACTCAAAAATCAGAACTGTAAGTTCA
CATTTATGCATGGATAAGCTGAAGACTAAAAATATACAGATTATATTTTCTGCATAAAAA
ATTAATGCTAAAAATTATAAGGATAGAATCTTAAAACCAAATATGAGCAAACTCTCGAAG
CACAAGATAGTATTGAATAATAAAATTAAGGATAAAAAAAGTAAAAAATAAGCAGCGATA
TAATACTTAAATTGAGTAGAATTATGTTCCTTCAACATTTAAATGCAACAACAAAAGCCT
CATATAATCTACTTAAATATTTGCTATGAGGATAATCTTATTAAAAAATAAAATAATTAT
TAGATATTTCGTAAGTATGTTAAGCTCTCAAAAAATTTAAAAAAAAAAAAATAATAATAA
TAATAAAATATAATAAAGCTATAAAGTTGTAAAATTAAAAGGAACTAACTCATTAAAAAA
ACTAAATAAATCAATGTAAGAGTGAAACATTTTACGTTTGTCTTTTGGTTCACTATTTCA
TTAATTTATTGACAAAATCATTTAAAACTTTGGCAAGCTGAGATAATTTTAAGGAAAGGA
AGGATGAGTGAAGTATTTGTTAAAAGCTGATTATTGCAAAAATATAATAATAAGAACTTC
ACTCAGGTGATTTATTTGTTGCATTGAAATAACAGGGGAAATCAATCAATTGTATAATTA
ATTAAGGAATAAATAAATAAATTAAATAAATAATTACTTAATAACCAACATGAATGTCCT
TTCAATTTCAAAACTAAAAAGTGGCTATTAGGGTTTAATTAAAAAAAAATGAAAATTTTC
TATCTATCTTGTCTGCGAGTAGTGAATAATTAATATGGAGAGAGCTAATTACTTAAATAA
AATAAGCTAAAATTAGAAATTCTAAAAATTAATTTCATAATTTAAATTAAACAATAGAGT
GTATTTTTAATGATTAAAATTTATTTTATTACTTTAGGTTGTTTGCTCTAGAATTTACGG
TCAAAGAGCTGCCATCAAGTTCGCTGGTTACACTCACTGCAAGTCTACCTCTTCTTCCAG
ATGGACTCCTGGTACCTTGACCAATTACTAGACCTTAAAATACGAAGAACCCAGAGTTCT
CATCGTCACTGATCCCAGATCTGACTTCTAAGCCATTAAGGAAGCTTCTTATGTCAACAT
TCCCGTTATTGCTTTGTGCGACTCTGACTCTCCTCTCGCCTACGTCGATGTTGTCATTCC
TTGCAACAACAGATCCACCGAATCTATCTCCATGATCTACTGGATGATCGCCAGAGAAGT
TAAAATCCTCAGAGGTGAACTCTCTAAGGACGAAGAATGGGAAGTTATGGTTGATCTCTT
CTACCACAAGACCCTCCCCACTGCTGAACAAAAGGAAGCTGAAGAAGAAGAAGGTGCTGA
AGGTGCTGAAGAAAAGGTCGCTGAAGTTAAGGAAGGTGAAGCTGAACAAAGTAATTTCTT
TATATTTAAATTAAAAATTTGAAAAATTAAATTGTCTTATTTAAAAATAGATACTGATAA
CAAAAACTGGTGA


>TTHERM_00522630(protein)
MATQRKQDDIKRLLASNCHQATINLNNQMKRYISHKGVNGIHYINIEETWQKIKLAARVI
AAVQHPEDVMVVCSRIYGQRAAIKFAGYTHCKSTSSSRWTPGTLTNYQTLKYEEPRVLIV
TDPRSDFQAIKEASYVNIPVIALCDSDSPLAYVDVVIPCNNRSTESISMIYWMIAREVKI
LRGELSKDEEWEVMVDLFYHKTLPTAEQKEAEEEEGAEGAEEKVAEVKEGEAEQNTDNKN
W