Identifiers and Description

Gene Model Identifier

TTHERM_00525070

Standard Name

CTH75 (CaTHepsin 75)

Aliases

PreTt06344 | 66.m00143 | 3722.m00002

Description

CTH75 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13352.1 4.000516897438123e-146
Description: papain family cysteine protease containing protein (333 aa)
Oxytricha Contig1254.0.g80 1.9990449803848145e-49
Description: Papain family cysteine protease
WormBase WBGene00000776 7.997143886232904e-48
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
DictyBase DDB_G0272298 2.000364041471746e-45
Description: DDB_G0272298 on chromosome: 2 position 1664020 to 1665049
Stentor Coeruleus SteCoe_29303 4.780892883885469e-25
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00525070(coding)
ATGAATAAAAAAATTTGGTGTGTTACACTTATTTTGCTTTTCTTGGCTAAATTTAATTGC
TAAGATGCAAAAAATACTGTTTCTGTTTAATCTTTGACTGCTTATAACAAATGGAGATTT
TCAAATTAAAGACTCTATTTAAATGAAGAAGAAGAAATCTTTAGATAAGCAATTTTCTTA
GAAAATTTTGCAAAGATCCAAGAGTTCAACCAAGACGGCAACAAAACTTATGAACAAACT
TTGAACTAATTTTCAGACATGACTTAGGATGAATTTGCTTAAAAAATTCTAAATCCAGTT
CTTTCTGCACCTAAAAATACCCCCACAGCATACTCAGCTACTCTCTATGAAGCTCCTTAG
AACTTTTAGATTCCTGACTCTTTTGATTGGAGAGCTTATGGTGCAGTCACATCAGTGAAA
AACTAAGGCTAATGTGGTTCTTGTTGGGCTTTTGCAGCTACTGGTGTTATGGAATCGTTT
AACTATATTCAAAATAGATAATTGAAAAGCTTTTCTGAATAACAGTTAGTTGACTGTGTT
ACTACAAGCAGAGGTTACAACTCCTATGGTTGTTAAGGAGGATATCCTGAAGAAGCTTTG
TCTTATTCTAAAAACTATGGTGTTTTGCAATCTCATGAATATCCATATGTCGGATTTTAA
GGTAATTGTAGAGTTTAATAACCTACAAGCGGTTACTATCCTAAAGAATTCGGTTAACTT
ACAAATACTGTTGATAATTTGAAATGGGGTATTTCATTTTCTCCTGTCTCAGTTCTTGTT
GATGCTACTAATTGGGGTTCTTACGGTTCAGGTGTTTTCAACAACTGTGATTCTTATGTT
AGAATCAATCACGCTGTTCTTGCAGTAGGATATGATAAATAAGGCAACTGGATAATTAAA
AACTCATGGGGAACTTATTGGGGTTAGTAAGGTTACATGACCTTAGCTGCTGGTAACAAC
TGTGGAATCTTAACCTCCAACTGGTTTGTTTACAGAGCATGA


>TTHERM_00525070(gene)
ATGAATAAAAAAATTTGGTGTGTTACACTTATTTTGCTTTTCTTGGCTAAATTTAATTGC
TAAGATGCAAAAAATACTGTTTCTGTTTAATCTTTGACTGCTTATAACAAATGGAGATTT
TCAAATTAAAGACTCTATTTAAATGAAGAAGAAGAAATCTTTAGATAAGCAATTTTCTTA
GAAAATTTTGCAAAGATCCAAGAGTTCAACCAAGACGGCAACAAAACTTATGAACAAACT
TTGAACTAATTTTCAGACATGACTTAGGATGAATTTGCTTAAAAAATTCTAAATCCAGTT
CTTTCTGCACCTAAAAATACCCCCACAGCATACTCAGCTACTCTCTATGAAGCTCCTTAG
AACTTTTAGATTCCTGACTCTTTTGATTGGAGAGCTTATGGTGCAGTCACATCAGTGAAA
AACTAAGGCTAATGTGGTTCTTGTTGGGCTTTTGCAGCTACTGGTGTTATGGAATCGTTT
AACTATATTCAAAATAGATAATTGAAAAGCTTTTCTGAATAACAGTTAGTTGACTGTGTT
ACTACAAGCAGAGGTTACAACTCCTATGGTTGTTAAGGAGGATATCCTGAAGAAGCTTTG
TCTTATTCTAAAAACTATGGTGTTTTGCAATCTCATGAATATCCATATGTCGGATTTTAA
GGTAATTGTAGAGTTTAATAACCTACAAGCGGTTACTATCCTAAAGAATTCGGTTAACTT
ACAAATACTGTTGATAATTTGAAATGGGGTATTTCATTTTCTCCTGTCTCAGTTCTTGTT
GATGCTACTAATTGGGGTTCTTACGGTTCAGGTGTTTTCAACAACTGTGATTCTTATGTT
AGAATCAATCACGCTGTTCTTGCAGTAGGATATGATAAATAAGGCAACTGGATAATTAAA
AACTCATGGGGAACTTATTGGGGTTAGTAAGGTTACATGACCTTAGCTGCTGGTAACAAC
TGTGGAATCTTAACCTCCAACTGGTTTGTTTACAGAGCATGA


>TTHERM_00525070(protein)
MNKKIWCVTLILLFLAKFNCQDAKNTVSVQSLTAYNKWRFSNQRLYLNEEEEIFRQAIFL
ENFAKIQEFNQDGNKTYEQTLNQFSDMTQDEFAQKILNPVLSAPKNTPTAYSATLYEAPQ
NFQIPDSFDWRAYGAVTSVKNQGQCGSCWAFAATGVMESFNYIQNRQLKSFSEQQLVDCV
TTSRGYNSYGCQGGYPEEALSYSKNYGVLQSHEYPYVGFQGNCRVQQPTSGYYPKEFGQL
TNTVDNLKWGISFSPVSVLVDATNWGSYGSGVFNNCDSYVRINHAVLAVGYDKQGNWIIK
NSWGTYWGQQGYMTLAAGNNCGILTSNWFVYRA