Identifiers and Description

Gene Model Identifier

TTHERM_00526450

Standard Name

RPS30 (Ribosomal Protein of the Small subunit 30)

Aliases

PreTt06383 | 66.m00182 | 3722.m00040

Description

RPS30 40S ribosomal protein S30; Homolog of yeast RPS30- human RPS30;

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13396.1 1.000159011384939e-43
Description: ribosomal protein S30 containing protein (81 aa)
Oxytricha Contig16083.0.g100 0.00000000000040012475857291343
Description: Ribosomal protein S30
SGD YOR182C 0.00000000019994075865167896
Description: RPS30B Protein component of the small (40S) ribosomal subunit; nearly identical to Rps30Ap and has similarity to rat S30 ribosomal protein
WormBase WBGene00004499 0.0000000010002658722841845
Description: locus:rps-30 status:Confirmed UniProt:Q18231 protein_id:CCD65769.1
DictyBase DDB_G0273743 0.000000030002053728821195
Description: rps30-2 on chromosome: 2 position 3349136 to 3349937

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00526450(coding)
ATGGGTCGTATGCACGGTACTCTCGCTAAGGCCGGTAAGGTCAGAAAATAAACCCCCAAG
GTTGAAAAGAAGGACAAGCCCAGAAAGACTCCTAAGGGTAGATCTTACAAGAGAATCCTC
TACAACAGAAGATATGCTCCTCACATCTTGGCCACTGATCCCAAGAAGAGAAAGTCTCCC
AACTGGCACGCTGGTAAGAAGGAAAAGATGGACGCTGCTGCCAATCCCGTCAAGAAGGAT
TGA


>TTHERM_00526450(gene)
ATGGGTAAGCCTTTTTTTTATTGAATATGCTGAACTTTCAAAATGCAAAATTTTTTCAAA
TGAACACCACTAAATTATTTTATCTTATTATAAAAACAGGTCGTATGCACGGTACTCTCG
CTAAGGCCGGTAAGGTAGGATATTCGCTTTATTCATTTTAAGCATCATCATGATGATATA
TTTTAATGATTTTTCTCTCCTTTCTTTAACGATTTGTATTAAGTTGAATTGGCAAATAGA
TAAATAAATATATTATTACCTTAAAAAGTAGAACAACATCTAATAGATTTTAAAATAAAT
TAAGGGAAAAAATGATATTTGATTCTTTGAAAATTATTTTAAGAATTCATTACACATTTA
GGCAAACAATACAAACAAATTTAGGGATATAAATATATAGATATGACAAATATTTTAATG
TATAAATTTCAAAGCTTTAAACAGCAAAAATTAATTGCTAATTTACTAAAAAAAGCTAAA
AGCGCTACTTAATTTGTTAAGAAATGAGAGAATTTCGTTAAAATATATTTTATTTTGCAA
ATTTCAAGCTATCAGAATCTAAATTTACTTATTTCTATTGAAAAAAATAGGTCAGAAAAT
AAACCCCCAAGGTTGAAAAGAAGGACAAGCCCAGAAAGACTCCTAAGGGTAGATCTTACA
AGAGAATCCTCTACAACAGAAGATATGCTCCTCACATCTTGGCCACTGATCCCAAGAAGA
GAAAGTCTCCCAACTGGCACGCTGGTAAGAAGGAAAAGATGGACGCTGCTGCCAATCCCG
TCAAGAAGGATTGA


>TTHERM_00526450(protein)
MGRMHGTLAKAGKVRKQTPKVEKKDKPRKTPKGRSYKRILYNRRYAPHILATDPKKRKSP
NWHAGKKEKMDAAANPVKKD