Identifiers and Description

Gene Model Identifier

TTHERM_00527400

Standard Name

CHN3 (CHitiNase 3)

Aliases

PreTt06472 | 66.m00271 | 3722.m00128

Description

CHN3 class I chitinase; Chitinase class I family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_16920 0
Description: None
Tetrahymena borealis EI9_13464.1 9.997093137033517e-262
Description: chitinase class I family protein (338 aa)
WormBase WBGene00020270 0.00000008001913847069386
Description: status:Partially_confirmed UniProt:O16512 protein_id:CCD72033.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00527400(coding)
ATGAAAACTCATTAAATTTATCTTATTTTCATTTCACTAATCCTACTTTTGTTAGGTTCT
TATATTATAATTTCATCAAATCATCCAAATAAGACTTCAAGAGATTTTAAGGCATGGCTT
TCTACAATTCCTCCTAATCCTTGGGGAGACACAAGTTTAAGAGCATTAATTAGAAATCTT
AATGGTGTTGTTACTGTTTAATAGCAAGATTCTTGGCTTGAGAGCATTACTGAAGCAGCA
AAATCTTTCCCAGATTTTTGCAATAGTGGAGATGAAGCTAAAGATAAATAAGAATTCTCA
GCATTCTTAACAATTATTGGTTATGAAACTTCATTTAACTCTGCTAATGGTTTTCCATGC
ACAATTGAAAATGGTTGTCCTAATTGTGATGTTTGTTCTTATAATTCACTCGGAAAAGAG
TGTTTAGAAGATGACCTTAAGTAATACTTTGGCAGAGGTCCTTTGCAGCTTTCTTGGAAT
TATAACTATGGACCATTCTCACAATATTACTTTCAAGATGATAGATTGTTAAGTAATCCA
AATATCTTGACAACAAATTAAACCTATTGCTGGGCTAGTGCTATTTGGTTTTGGATGACA
AAATAAAATTATGGAGGTTGGTGTATGCCTTAAGTTGCATGGCCAGGCAAAAATTAATGC
GATTTAGATTGCCCTAACGGACCCTCTAGTTGTAAGAATAGCTAATGTACTTCAAATCAT
TGGATGGAACTTTAAAACGCTAGTTGTCATGATGCTATTCATACAGGTAATGGAATAGGC
TAAGTAATTAATATTATTAATGGACTTTATGATTGTTGTCCCTCAAGTACTTACTTTGCT
TAAGGAGGACACACAATAGACAGAATATCATCTTTTGTTTAAATTCTTGAAAATTGGAAT
GAGCCTATTCCATTTAAGGTATTAAATCCTGCTCCTATCTATGATTGCCCTATAGCTCTT
AATCACGTAAACTGCTAAAATATTGAATAAACTGGGTCATGCAGAGCTATGTGA


>TTHERM_00527400(gene)
ATGAAAACTCATTAAATTTATCTTATTTTCATTTCACTAATCCTACTTTTGTTAGGTTCT
TATATTATAATTTCATCAAATCATCCAAATAAGACTTCAAGAGATTTTAAGGCATGGCTT
TCTACAATTCCTCCTAATCCTTGGGGAGACACAAGTTTAAGAGCATTAATTAGAAATCTT
AATGGTGTTGTTACTGTTTAATAGCAAGATTCTTGGCTTGAGAGCATTACTGAAGCAGCA
AAATCTTTCCCAGATTTTTGCAATAGTGGAGATGAAGCTAAAGATAAATAAGAATTCTCA
GCATTCTTAACAATTATTGGTTATGAAACTTCATTTAACTCTGCTAATGGTTTTCCATGC
ACAATTGAAAATGGTTGTCCTAATTGTGATGTTTGTTCTTATAATTCACTCGGAAAAGAG
TGTTTAGAAGATGACCTTAAGTAATACTTTGGCAGAGGTCCTTTGCAGCTTTCTTGGAAT
TATAACTATGGACCATTCTCACAATATTACTTTCAAGATGATAGATTGTTAAGTAATCCA
AATATCTTGACAACAAATTAAACCTATTGCTGGGCTAGTGCTATTTGGTTTTGGATGACA
AAATAAAATTATGGAGGTTGGTGTATGCCTTAAGTTGCATGGCCAGGCAAAAATTAATGC
GATTTAGATTGCCCTAACGGACCCTCTAGTTGTAAGAATAGCTAATGTACTTCAAATCAT
TGGATGGAACTTTAAAACGCTAGTTGTCATGATGCTATTCATACAGGTAATGGAATAGGC
TAAGTAATTAATATTATTAATGGACTTTATGATTGTTGTCCCTCAAGTACTTACTTTGCT
TAAGGAGGACACACAATAGACAGAATATCATCTTTTGTTTAAATTCTTGAAAATTGGAAT
GAGCCTATTCCATTTAAGGTATTAAATCCTGCTCCTATCTATGATTGCCCTATAGCTCTT
AATCACGTAAACTGCTAAAATATTGAATAAACTGGGTCATGCAGAGCTATGTGA


>TTHERM_00527400(protein)
MKTHQIYLIFISLILLLLGSYIIISSNHPNKTSRDFKAWLSTIPPNPWGDTSLRALIRNL
NGVVTVQQQDSWLESITEAAKSFPDFCNSGDEAKDKQEFSAFLTIIGYETSFNSANGFPC
TIENGCPNCDVCSYNSLGKECLEDDLKQYFGRGPLQLSWNYNYGPFSQYYFQDDRLLSNP
NILTTNQTYCWASAIWFWMTKQNYGGWCMPQVAWPGKNQCDLDCPNGPSSCKNSQCTSNH
WMELQNASCHDAIHTGNGIGQVINIINGLYDCCPSSTYFAQGGHTIDRISSFVQILENWN
EPIPFKVLNPAPIYDCPIALNHVNCQNIEQTGSCRAM