Identifiers and Description

Gene Model Identifier

TTHERM_00529810

Standard Name

Brop-4 (Bromodomain containing protein 4)

Aliases

PreTt04650 | 67.m00165 | 3684.m00035

Description

bromodomain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13669.1 7.996964956232603e-130
Description: bromodomain containing protein (288 aa)
Oxytricha Contig18584.0.g108 7.003307964816097e-28
Description: Bromodomain
WormBase WBGene00022473 4.997543945741262e-17
Description: locus:bet-1 status:Partially_confirmed UniProt:Q95Y80 protein_id:CCD68309.1
SGD YDL070W 9.997764199084386e-16
Description: BDF2 Protein involved in transcription initiation at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf1p
DictyBase DDB_G0293800 0.000000000007996637300921877
Description: DDB_G0293800 on chromosome: 6 position 3334534 to 3337072
Stentor Coeruleus SteCoe_29693 0.000000000013887943864964021
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00529810(coding)
ATGGATAAATAAGTATAAAGTGAATGCAGTAAAGTTTTGAAATAGCTGCTTAAGTTACCA
GAATCATATCCTTTTAGAGAACCAGTCGATTATGAATAATTATAGTTATTTGATTACCCT
GATATTATAAAAAATCCTATGGATTTAGGCACGATAGAATAAAACTTAAAAGCAAAAAAA
TATAAATAGCCTAAAGACTTCTTTGATGACATATTTTTAGTGTGGAATAATTGTAAAATG
TACAATCAAGATGGATCTAACATTTATTAGTAAGCTTTAAATATGGAAAAAGCTACTAAT
GCTGCTAAATATGCTTTTGAATAGTCCTTAAAAAAGCTAAATTAAACCTAAGCACAAGCA
ACATAAAACCAATCTTCTTCAGCTGGCATAGCTGGTAAGTAAAAAAAGACAGAAAAATCA
GTTAGTTCATCTATAATTAAAAAGAAAATCCATAAAAACAAAGAAGGAAGCAGTAGCATT
ACAGTAAATACTAATACAAACGTGAATGTAGCATCAGGAAATAATAATAATGGAAATAAC
AATAATACTTAATATTAACAATAATAAAATGTCTAGAGTGTATAATATAGTAAAAAAGAA
AGGCAACCACCTGTCAATAAAAATGAATAATAGTAAGAAAAATATGCTAATTAGCAAGAA
AGAAAATATGCTCATATATCACTTAGATTAAATTTAGCTTTTAAATTAAAAAATGCTACA
GAAGATAAGTTAGTAAATTTATTTGCTATGCTTGCAGAAAAACACCCTGAAACACTTTCA
AATATAGAAAATAGAGAACAAAAGCTCTCTATGAATTTGACCTAGTTACCTGATCAAACT
ATTTAAAATATGATAGCAGCATTAGAATTCAAAGATTGA


>TTHERM_00529810(gene)
ATGGATAAATAAGTATAAAGTGAATGCAGTAAAGTTTTGAAATAGCTGCTTAAGTTACCA
GAATCATATCCTTTTAGAGAACCAGTCGATTATGAATAATTATAGTTATTTGATTACCCT
GATATTATAAAAAATCCTATGGATTTAGGCACGATAGAATAAAACTTAAAAGCAAAAAAA
TATAAATAGCCTAAAGACTTCTTTGATGACATATTTTTAGTGTGGAATAATTGTAAAATG
TACAATCAAGATGGATCTAACATTTATTAGTAAGCTTTAAATATGGAAAAAGCTACTAAT
GCTGCTAAATATGCTTTTGAATAGTCCTTAAAAAAGCTAAATTAAACCTAAGCACAAGCA
ACATAAAACCAATCTTCTTCAGCTGGCATAGCTGGTAAGTAAAAAAAGACAGAAAAATCA
GTTAGTTCATCTATAATTAAAAAGAAAATCCATAAAAACAAAGAAGGAAGCAGTAGCATT
ACAGTAAATACTAATACAAACGTGAATGTAGCATCAGGAAATAATAATAATGGAAATAAC
AATAATACTTAATATTAACAATAATAAAATGTCTAGAGTGTATAATATAGTAAAAAAGAA
AGGCAACCACCTGTCAATAAAAATGAATAATAGTAAGAAAAATATGCTAATTAGCAAGAA
AGAAAATATGCTCATATATCACTTAGATTAAATTTAGCTTTTAAATTAAAAAATGCTACA
GAAGATAAGTTAGTAAATTTATTTGCTATGCTTGCAGAAAAACACCCTGAAACACTTTCA
AATATAGAAAATAGAGAACAAAAGCTCTCTATGAATTTGACCTAGTTACCTGATCAAACT
ATTTAAAATATGATAGCAGCATTAGAATTCAAAGATTGA


>TTHERM_00529810(protein)
MDKQVQSECSKVLKQLLKLPESYPFREPVDYEQLQLFDYPDIIKNPMDLGTIEQNLKAKK
YKQPKDFFDDIFLVWNNCKMYNQDGSNIYQQALNMEKATNAAKYAFEQSLKKLNQTQAQA
TQNQSSSAGIAGKQKKTEKSVSSSIIKKKIHKNKEGSSSITVNTNTNVNVASGNNNNGNN
NNTQYQQQQNVQSVQYSKKERQPPVNKNEQQQEKYANQQERKYAHISLRLNLAFKLKNAT
EDKLVNLFAMLAEKHPETLSNIENREQKLSMNLTQLPDQTIQNMIAALEFKD