Identifiers and Description

Gene Model Identifier

TTHERM_00530350

Standard Name

PRP12 (Pre-mRNA Processing factor 12)

Aliases

PreTt04698 | 67.m00213 | 3684.m00083

Description

PRP12 splicing factor 3B subunit 3; CPSF A subunit region family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_1863 0
Description: None
WormBase WBGene00019323 9.997093137033517e-262
Description: locus:teg-4 status:Partially_confirmed UniProt:O44985 protein_id:CCD68627.1
Tetrahymena borealis EI9_13616.1 9.997093137033517e-262
Description: CPSF A subunit region family protein (1198 aa)
DictyBase DDB_G0282569 9.997093137033517e-262
Description: sf3b3 on chromosome: 3 position 5947254 to 5951124
Oxytricha Contig1943.0.g12 9.997093137033517e-262
Description: CPSF A subunit region
SGD YML049C 1.0003292389192957e-45
Description: RSE1 Protein involved in pre-mRNA splicing; component of the pre-spliceosome; associates with U2 snRNA; involved in ER to Golgi transport

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00530350(coding)
ATGATGAACTTATACAGTTTAACGCTGTTATAACCAACAGCTATTTTAAAAGCAGTATAC
GGTAATTTTTCAGGACCTAAAGCTTAGGAAATTGCTGTAGCTAAAGGAAAAGTTTTAGAA
ATTCTCACTCCAGATGAAAATAATTCAGGTAAATTAAGGGTAGTACACTCAGAAGAAGTA
TTTGGTATCATAAGGACTATTAACATTTTCAGGTTGCATGGTCAAACTTAAGATTATATC
ATAGTTGGTTCAGATAGCGGTAGAATAGTTATTTTGAAATTTAATAAAGAAAAGGGAGAG
TTTGAAAAAGTTCATTAAGAGACATATGGAAAAACAGGGTGTCGTCGTATTGTACCTGGT
TAATATATAGCAGTAGATCCTAAAGGTCGTGCTTGCATGTTTGCAGCAATTGAAAAATAA
AAGTTTGTATACATTTTAAATAGAGATAATGAAGATAAGTTGACCATTTCATCTCCTTTA
GAAGCACATAAATCACATACACTTTGCTATGATATAATAGGTATTGATGTAGGCTATGAA
AATTCATAATTTGCTTGTATTGAGTGTGATTACGGTGAGGTTGAATAAAAAGATTCAGCT
GTTCACACTGGATAAATATAAAAATAGCTTACAATTTATGAATTGGATTTCGGTTTAAAT
CATGTCGTAAAAAAATCATCTGAACCTATTCCCGAAACTGCTCATATGCTTCTTCCAGTT
CCTGGTCTACCTGATGGTCCTGGAGGAGTGTTAATTGCTTGTGAAGATATGTTAATATAT
AAAGGAAATAATTAAGAATTAAAATGTAGATATCCTTAAAGATTTAGTACCAGCAAAATT
ATGATTAACTCCTTTGGTTTCCTAAAGCAAAAATCAAAAAACTAAAATCTCTCATTTTTT
TTATTACAAACTGAATTGGGAGATTTATTCAAATTATAGATTAAAAGTACAGATGATAAA
GTTCATGGATTGACATTATAATATTTTGATTCTATTCCAACTGCTATTTCAATTTGTATT
ACTAAAACTGGTCACCTGTTTGCAGCATGTGAAAAAGGAGATCACTTGCTCTATAGATTT
AAATCTCTTGGTGAATAAGAAGAAAGACCCACCAAAACTACATCAGCAGACTTCGAGTAA
TAGGCTATTTTTATTCCTCGTAAGCTAGTAAATTTAGAACAAGTTGACTCTCTTGATAAT
CTTTCAGCTATCAGTGATATCAAAGTTAATGATTTAACTGGCGAAGGTAATCCTTAAATA
TACGCATTATGTGCTGCTGGTAGTAGAAGTACTTTAAGAATATTACGTCATGGTTTGTAA
GTCAGTGAATATGCAACAAGTAGATTGCCATTAAGACCTAACGGTATTTGGACAATTAAG
TAAAGACATGATGAAGGTTTAACAAAATATATTGTGTTAAGTAGCAGCAAAAAAACTTAT
GTTCTTTCTATTAAAGATACTATTTCTGCAGTTAATGACTCCAGTTTAGATACAAATAGT
CAAACTCTTCATGCTGGTATTTTAGAAAATAATTGCATAATCCAAGTTACTCCAGAATCA
TTTAGATAAATTAGAGATAACAGAGTTACTTTATATAAAACAGAATCAAATAAATTCGTG
AAAGCATGCTCTAATTCTAGATAAATTGCATTAGCATTATAAGGAGGCCAAGGATAACCC
GGTGGTGATATTATTTATTTCGAATTCGATCTTGGTGGTTAGCTCAAAAGAATCGAAGAA
AAGGCTAAATTAACTTCAGATATTGAATGCATAGATATAGGTGAAGTTCCAATAGGGCGT
CCAAAATTCAAATTTTTAGCTGTTGGATGCAAAGATTAAACAGTAAGAATTTTGAGTTTA
GAATAAGATCAATACCTCTAAAGATTGAGTTTATAGGCTCTTCCAGGTATTCCAGAAAGT
GTTAGCTTAATTGAAATGAAGAGAGGCACAGGAACTGAGTAAGAAGCTGAGGAATATTAA
CTTTATTTGTTTGTTGGTTTACAAAATGGTATTCTTTTAAGAGCAACTGTTGACTAAGTT
ACTGGTTCTTTGTCTGATGTTAGAACTAGAGTTCTCAGCGCTGCTCCTATTCGTACTTGT
AAGTATGTTGTTTAAGGATAACCTGCTTTATTGGCTCTCTCTACTCGTCCTTGGATATGT
TATACCTATTTAGGAAAGTACTAAATGGTTCCTATCTCCTATGATATGCTCGAATATGCT
GCTCCTGCAGTTTTTAATATGTAAGGAGAGTAAAAGTAATGTATAGTATCTACTTCAGGT
GAGTCCGTTCGTATTATTGAACCATAAAAGTATGGAGATTTACTCAATCAATAAGTTATA
AAATTGCGTTATTCACCTCGTAAAATGGCAATCCATGAAAGATCACATAATATAGTCTTA
ATTGAATCTGATAATAAGGTTTATAATGAATCTTAAAAGAAGTAGCTTATCGAATAGTAT
TATAGTAACTAAAACAAAGGTGATTTAGCCACTCAAGTAGATCTCTTAACAGCTCCTTCT
GGTAACTGGGCTTCTTGTGTTCGTATAGTCGATCCTGTTACTCGTAAAACTCTTAATATT
TATGAATTAGAAAATAACGAGCACGCCCTTTCTATGTGTATGGTAAACTTTGATAACAAA
GATGAGACTTATGTTTGTGTTGGTACTGTTAAGGATTATTAAGTTCATCCAAATAGAAAT
TTCTCTGTTTGTTATATAAATACTTTCTAGCTTAACGAAAAGTTGAATACTCTTGAATTG
CTCCATAAAACTGAGATATTTGAAATTCCAGGCGCCTTGCATGCTCATAAAGGAAAATTA
CTTGCTGGATGTGGCACATTTTTAAGATATTATGAACTTGGTAAGAAGAAATTATTGAAA
AAAGCAGAAATTAAAGGTTTACAATCTCCAGTTAATGGAATTTAAACATTTGGAGATAGA
ATATATGTATCTATGGTTGCTGACTCTGTCCATGTCCTCAAGTATCGCTCTAAAGACTAG
ACATTTTATGAGGTTTGTGATGATATATTACCAAGATGGATGTCTTCCTTTTAAGTTCTT
GATTATCATACTTATATTGGTGGAGATAAATTTGAGAATGCATTTGTCTGTAGAGTACCG
TCAAATGCTGATGAAGAAATGGAAGAAAATCCTATGGCTTATAAATTAAGATGGGAAACA
GGATATTTGAATGGAGCTCCTTTCAAAACTGAACAAATTTGCCACTTTTATGCTGGCGAA
GTAATAACAACATTACAAAAAGCAAGTTTAGTTTCAACAGGAAATGAAATAGTATTATAT
GGAACAAGTATGGGCTCAATAGGTGCTTATTTACCTTTCCAAACAAAGGAAGATATAGAT
TTCTTTATTCATTTAGAAATGTATCTACGTTTAGACGTTCTTCCATTGGCTGGTAGAGAT
CACGTTATGTTCAGATCTTTCTATGGTCCAGTCAAATCCGTAATCGATGGAGATCTTTGC
GAATAATTCATAAAATTAAGTTCAGGTAAATAAAAAGTGTTAGCAGATGAAATGGATAGA
CATCCACACGAAGTACATAAAAAATTAGATGAAATCAGAAATAAAATTCTTTGA


>TTHERM_00530350(gene)
ATGATGAACTTATACAGTTTAACGCTGTTATAACCAACAGCTATTTTAAAAGCAGTATAC
GGTAATTTTTCAGGACCTAAAGCTTAGGAAATTGCTGTAGCTAAAGGAAAAGTTTTAGAA
ATTCTCACTCCAGATGAAAATAATTCGTAAAACTAATTTTTATAAATGGCATTATAATAT
CAAACAAAAATCCTTAAAAGTTGTGATTTTTAAAACGCTTCAAGGACAGACAATTAAAAT
AAATCATTTGCAAAATTTCTATTTTAAAATATTAAAAAAATTATATAAATAGAGGTAAAT
TAAGGGTAGTACACTCAGAAGAAGTATTTGGTATCATAAGGACTATTAACATTTTCAGGT
TGCATGGTGTAATTAATTATCTATTATAAATCAATAAATATTTAAATAATATTCAAAATT
GATCTAATAACATTTTGAACTATATAATGACCTTTGTTTTTCTAAATTCATAAACAAAAT
ATTTTTTTATTATACAGCAAACTTAAGATTATATCATAGTTGGTTCAGATAGCGGTAGAA
TAGTTATTTTGAAATTTAATAAAGAAAAGGGAGAGTTTGAAAAAGTTCATTAAGAGACAT
ATGGAAAAACAGGGTGTCGTCGTATTGTACCTGGTTAATATATAGCAGTAGATCCTAAAG
GTCGTGCTTGCATGTTTGCAGCAATTGAAAAATAAAAGTTTGTATACATTTTAAATAGAG
ATAATGAAGATAAGTTGACCATTTCATCTCCTTTAGAAGCACATAAATCACATACACTTT
GCTATGATATAATAGGTATTGATGTAGGCTATGAAAATTCATAATTTGCTTGTATTGAGT
GTGATTACGGTGAGGTTGAATAAAAAGATTCAGCTGTTCACACTGGATAAATATAAAAAT
AGCTTACAATTTATGAATTGGATTTCGGTTTAAATCATGTCGTAAAAAAATCATCTGAAC
CTATTCCCGAAACTGCTCATATGCTTCTTCCAGGTAAAATATAATCTTTATTTCTAATTA
TTTAAAACATTTTATTAATAATGCATAGTTCCTGGTCTACCTGATGGTCCTGGAGGAGTG
TTAATTGCTTGTGAAGATATGTTAATATATAAAGGAAATAATTAAGAATTAAAATGTAGA
TATCCTTAAAGATTTAGTACCAGCAAAATTATGATTAACTCCTTTGGTTTCCTAAAGCAA
AAATCAAAAAACTAAAATCTCTCATTTTTTTTATTACAAACTGAATTGGGAGATTTATTC
AAATTATAGATTAAAAGTACAGATGATAAAGTTCATGGATTGACATTATAATATTTTGAT
TCTATTCCAACTGCTATTTCAATTTGTATTACTAAAACTGGTCACCTGTTTGCAGCATGT
GAAAAAGGAGATCACTTGCTCTATAGATTTAAATCTCTTGGTGAATAAGAAGAAAGACCC
ACCAAAACTACATCAGCAGACTTCGAGTAATAGGCTATTTTTATTCCTCGTAAGCTAGTA
AATTTAGAACAAGTTGACTCTCTTGATAATCTTTCAGCTATCAGTGATATCAAAGTTAAT
GATTTAACTGGCGAAGGTAATCCTTAAATATACGCATTATGTGCTGCTGGTAGTAGAAGT
ACTTTAAGAATATTACGTCATGGTTTGTAAGTCAGTGAATATGCAACAAGTAGATTGCCA
TTAAGACCTAACGGTATTTGGACAATTAAGTAAAGACATGATGAAGGTTTAACAAAATAT
ATTGTGTTAAGTAGCAGCAAAAAAACTTATGTTCTTTCTATTAAAGATACTATTTCTGCA
GTTAATGACTCCAGTTTAGATACAAATAGTCAAACTCTTCATGCTGGTATTTTAGAAAAT
AATTGCATAATCCAAGTAATTTATTTTATTTTTAAATTATTTCTAACCAAAAGAAATTTC
AATTATTAAAAATGAAAGATAATAAAACGATCAAATTATATTTACAAATATTTTATTTAA
ATGATCTAAAACTAATTTTGAATAAAATAATGAAATTTTTAAAAAATAAAATTTTAAGCA
AATAAATTAATTATTTATTTATTTTTTTATTTATTTATTAAATTAGGTTACTCCAGAATC
ATTTAGATAAATTAGAGATAACAGAGTTACTTTATATAAAACAGAATCAAATAAATTCGT
GAAAGCATGCTCTAATTCTAGATAAATTGCATTAGCATTATAAGGAGGCCAAGGATAACC
CGGTGGTGATATTATTTATTTCGAATTCGATCTTGGTGGTTAGCTCAAAAGAATCGAAGA
AAAGGCTAAATTAACTTCAGATATTGAATGCATAGATATAGGTGAAGTTCCAATAGGGCG
TCCAAAGTAAGATTAATAATTGTAAATTAGTATTTATAAAAAATATATTATTTATTTAAA
ATAGATTCAAATTTTTAGCTGTTGGATGCAAAGATTAAACAGTAAGAATTTTGAGTTTAG
AATAAGATCAATACCTCTAAAGATTGAGTTTATAGGCTCTTCCAGGTATTCCAGAAAGTG
TTAGCTTAATTGAAATGAAGAGAGGCACAGGAACTGAGTAAGAAGCTGAGGAATATTAAC
TTTATTTGTTTGTTGGTTTACAAAATGGTATTCTTTTAAGAGCAACTGTTGACTAAGTTA
CTGGTTCTTTGTCTGATGTTAGAACTAGAGTTCTCAGCGCTGCTCCTATTCGTACTTGTA
AGTATGTTGTTTAAGGATAACCTGCTTTATTGGCTCTCTCTACTCGTCCTTGGATATGTT
ATACCTATTTAGGAAAGTACTAAATGGTTCCTATCTCCTATGATATGCTCGAATATGCTG
CTCCTGCAGTTTTTAATATGTAAGGAGAGTAAAAGTAATGTATAGTATCTACTTCAGGTG
AGTCCGTTCGTATTATTGAACCATAAAAGTATGGAGATTTACTCAATCAATAAGTTATAA
AATTGCGTTATTCACCTCGTAAAATGGCAATCCATGAAAGATCACATAATATAGTCTTAA
TTGAATCTGATAATAAGGTTTATAATGAATCTTAAAAGAAGTAGCTTATCGAATAGTATT
ATAGTAACTAAAACAAAGGTGATTTAGCCACTCAAGTAGATCTCTTAACAGCTCCTTCTG
GTAACTGGGCTTCTTGTGTTCGTATAGTCGATCCTGTTACTCGTAAAACTCTTAATATTT
ATGAATTAGAAAATAACGAGCACGCCCTTTCTATGTGTATGGTAAACTTTGATAACAAAG
ATGAGACTTATGTTTGTGTTGGTACTGTTAAGGATTATTAAGTTCATCCAAATAGAAATT
TCTCTGTTTGTTATATAAATACTTTCTAGCTTAACGAAAAGTTGAATACTCTTGAATTGC
TCCATAAAACTGAGATATTTGAAATTCCAGGCGCCTTGCATGCTCATAAAGGAAAATTAC
TTGTAATTTATTTTTTAAAATTAAAAATTATAAAATTTAAATCATTTATTTTAATAAAAG
GCTGGATGTGGCACATTTTTAAGATATTATGAACTTGGTAAGAAGAAATTATTGAAAAAA
GCAGAAATTAAAGGTTTACAATCTCCAGTTAATGGAATTTAAACATTTGGAGATAGAATA
TATGTATCTATGGTTGCTGACTCTGTCCATGTCCTCAAGTATCGCTCTAAAGACTAGACA
TTTTATGAGGTTTGTGATGATATATTACCAAGATGGATGTCTTCCTTTTAAGTTCTTGAT
TATCATACTTATATTGGTGGAGATAAATTTGAGAATGCATTTGTCTGTAGAGTACCGTCA
AGTAATTAGTTTTATTTTATTAAATTTAAGAATTCAATTTATTTTTATATTTAGATGCTG
ATGAAGAAATGGAAGAAAATCCTATGGCTTATAAATTAAGATGGGAAACAGGATATTTGA
ATGGAGCTCCTTTCAAAGTATCAATTTATTTATTTATCAAAAATAAAATATTAAATTTTT
TAATTAAATAGACTGAACAAATTTGCCACTTTTATGCTGGCGAAGTAATAACAACATTAC
AAAAAGCAAGTTTAGTTTCAACAGGAAATGAAATAGTATTATATGGAACAAGTATGGGCT
CAATAGGTGCTTATTTACCTTTCCAAACAAAGGAAGATATAGATTTCTTTATTCATTTAG
AAATGTATCTACGTTTAGACGTTCTTCCATTGGCTGGTAGAGATCACGTTATGTTCAGAT
CTTTCTATGGTCCAGTCAAAGTAAAAAATAATTTATAATTAAATATCTTTATTTAAATAA
TTTCTTTAATATAGTCCGTAATCGATGGAGATCTTTGCGAATAATTCATAAAATTAAGTT
CAGGTAAATAAAAAGTGTTAGCAGATGAAATGGATAGACATCCACACGAAGTACATAAAA
AATTAGATGAAATCAGAAATAAAATTCTTTGA


>TTHERM_00530350(protein)
MMNLYSLTLLQPTAILKAVYGNFSGPKAQEIAVAKGKVLEILTPDENNSGKLRVVHSEEV
FGIIRTINIFRLHGQTQDYIIVGSDSGRIVILKFNKEKGEFEKVHQETYGKTGCRRIVPG
QYIAVDPKGRACMFAAIEKQKFVYILNRDNEDKLTISSPLEAHKSHTLCYDIIGIDVGYE
NSQFACIECDYGEVEQKDSAVHTGQIQKQLTIYELDFGLNHVVKKSSEPIPETAHMLLPV
PGLPDGPGGVLIACEDMLIYKGNNQELKCRYPQRFSTSKIMINSFGFLKQKSKNQNLSFF
LLQTELGDLFKLQIKSTDDKVHGLTLQYFDSIPTAISICITKTGHLFAACEKGDHLLYRF
KSLGEQEERPTKTTSADFEQQAIFIPRKLVNLEQVDSLDNLSAISDIKVNDLTGEGNPQI
YALCAAGSRSTLRILRHGLQVSEYATSRLPLRPNGIWTIKQRHDEGLTKYIVLSSSKKTY
VLSIKDTISAVNDSSLDTNSQTLHAGILENNCIIQVTPESFRQIRDNRVTLYKTESNKFV
KACSNSRQIALALQGGQGQPGGDIIYFEFDLGGQLKRIEEKAKLTSDIECIDIGEVPIGR
PKFKFLAVGCKDQTVRILSLEQDQYLQRLSLQALPGIPESVSLIEMKRGTGTEQEAEEYQ
LYLFVGLQNGILLRATVDQVTGSLSDVRTRVLSAAPIRTCKYVVQGQPALLALSTRPWIC
YTYLGKYQMVPISYDMLEYAAPAVFNMQGEQKQCIVSTSGESVRIIEPQKYGDLLNQQVI
KLRYSPRKMAIHERSHNIVLIESDNKVYNESQKKQLIEQYYSNQNKGDLATQVDLLTAPS
GNWASCVRIVDPVTRKTLNIYELENNEHALSMCMVNFDNKDETYVCVGTVKDYQVHPNRN
FSVCYINTFQLNEKLNTLELLHKTEIFEIPGALHAHKGKLLAGCGTFLRYYELGKKKLLK
KAEIKGLQSPVNGIQTFGDRIYVSMVADSVHVLKYRSKDQTFYEVCDDILPRWMSSFQVL
DYHTYIGGDKFENAFVCRVPSNADEEMEENPMAYKLRWETGYLNGAPFKTEQICHFYAGE
VITTLQKASLVSTGNEIVLYGTSMGSIGAYLPFQTKEDIDFFIHLEMYLRLDVLPLAGRD
HVMFRSFYGPVKSVIDGDLCEQFIKLSSGKQKVLADEMDRHPHEVHKKLDEIRNKIL