Identifiers and Description

Gene Model Identifier

TTHERM_00530660

Standard Name

CTH99 (CaTHepsin 99)

Aliases

PreTt04729 | 67.m00244 | 3684.m00114

Description

CTH99 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_13588.1 1.0001465636795248e-178
Description: papain family cysteine protease containing protein (326 aa)
DictyBase DDB_G0272815 7.00308173940364e-57
Description: cprE on chromosome: 2 position 2212329 to 2213613
Oxytricha Contig19092.0.g43 2.000065869309806e-55
Description: Papain family cysteine protease
WormBase WBGene00007055 1.9998745702418095e-48
Description: locus:tag-196 status:Confirmed UniProt:O16454 protein_id:CCD64084.1
Stentor Coeruleus SteCoe_8145 1.185064864233981e-27
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00530660(coding)
ATGAGAACTCAATTGCTTATTGCTGCTGCTTTAGGTTTAACCTTATTAGGTTTAACTTCC
TATTTATTCCTCCACAAGTCTACTCAAGTTGGATACACTGATGACTAAATTAACATGTGG
AAGGGCTTCAAGAAGACCTACAACAAAAAATTCTCTTCTGAAGATGCTGACTAAGAAGCT
TACAGAATGAACGTCTTCTTCGATAACGTTGAATACGCTTCATAAGATTCTACCATGGGT
ATTACCAAGTTTATGGACCTTACCCCTGTTGAATTTGCCTAACTTTACTTGAATCCCATT
GAAAACGTTGAAGGTTCTATTGAAACTTTCTAAGCTATTCAAGCTAATGGAGATATTGTT
GTCGATTGGGTTGCTAAGGGTGCTGTCACACCTGTTAAGGATCAAGGTGGTTGTGGTGGT
TGTTGGTCTTTCGCTACTACTGGTGGTGTTGAAGGTGCTAACTTTGTCTACAAAAATGTC
CTCCCTAACTTATCTGAACAATAATTAATCGACTGTGACACTTAAAACAGTGGTTGCGGT
GGTGGTTTAAGAGACGTTGCCTTAAACTACGTTAAGGCAACTGGTTTGGCCACTGAATAA
GATTATCCTTATGAAGCTAAGGATGGTAAGTGCAGACTTGAAGGTAAGAGCCACCCTTGG
ACTGTTTCTGGTTACACTTCTATTAAGTAATGCGCTGACCTCGTTACTGCTATTCAAAAG
GCCCCTGTTACCGTTGGTATCGATGCTTCTAACCTCTAATTCTACACTGGTGGTATCTTT
TCTAAGTGCGCCACTAACATCAACCACGGTGTTTTACTTGTTGGTTACGACTCTGTTAAT
CAATCTTGGAAGGTCAAGAACTCCTGGGGTCCTAACTTCGGTGAACACGGTTACTTCTAA
CTCTCTGCTAAGGTTACTGGTGACCAAATTGCTAACACTTGCGGTATTTGCTCTAGAGCT
TATGCTCCTTACATTTGA


>TTHERM_00530660(gene)
ATGAGAACTCAATTGCTTATTGCTGCTGCTTTAGGTTTAACCTTATTAGGTTTAACTTCC
TATTTATTCCTCCACAAGTCTACTCAAGTTGGATACACTGATGACTAAATTAACATGTGG
AAGGGCTTCAAGAAGACCTACAACAAAAAATTCTCTTCTGAAGATGCTGACTAAGAAGCT
TACAGAATGAACGTCTTCTTCGATAACGTTGAATACGCTTCATAAGATTCTACCATGGGT
ATTACCAAGTTTATGGACCTTACCCCTGTTGAATTTGCCTAACTTTACTTGAATCCCATT
GAAAACGTTGAAGGTTCTATTGAAACTTTCTAAGCTATTCAAGCTAATGGAGATATTGTT
GTCGATTGGGTTGCTAAGGGTGCTGTCACACCTGTTAAGGATCAAGGTGGTTGTGGTGGT
TGTTGGTCTTTCGCTACTACTGGTGGTGTTGAAGGTGCTAACTTTGTCTACAAAAATGTC
CTCCCTAACTTATCTGAACAATAATTAATCGACTGTGACACTTAAAACAGTGGTTGCGGT
GGTGGTTTAAGAGACGTTGCCTTAAACTACGTTAAGGCAACTGGTTTGGCCACTGAATAA
GATTATCCTTATGAAGCTAAGGATGGTAAGTGCAGACTTGAAGGTAAGAGCCACCCTTGG
ACTGTTTCTGGTTACACTTCTATTAAGTAATGCGCTGACCTCGTTACTGCTATTCAAAAG
GCCCCTGTTACCGTTGGTATCGATGCTTCTAACCTCTAATTCTACACTGGTGGTATCTTT
TCTAAGTGCGCCACTAACATCAACCACGGTGTTTTACTTGTTGGTTACGACTCTGTTAAT
CAATCTTGGAAGGTCAAGAACTCCTGGGGTCCTAACTTCGGTGAACACGGTTACTTCTAA
CTCTCTGCTAAGGTTACTGGTGACCAAATTGCTAACACTTGCGGTATTTGCTCTAGAGCT
TATGCTCCTTACATTTGA


>TTHERM_00530660(protein)
MRTQLLIAAALGLTLLGLTSYLFLHKSTQVGYTDDQINMWKGFKKTYNKKFSSEDADQEA
YRMNVFFDNVEYASQDSTMGITKFMDLTPVEFAQLYLNPIENVEGSIETFQAIQANGDIV
VDWVAKGAVTPVKDQGGCGGCWSFATTGGVEGANFVYKNVLPNLSEQQLIDCDTQNSGCG
GGLRDVALNYVKATGLATEQDYPYEAKDGKCRLEGKSHPWTVSGYTSIKQCADLVTAIQK
APVTVGIDASNLQFYTGGIFSKCATNINHGVLLVGYDSVNQSWKVKNSWGPNFGEHGYFQ
LSAKVTGDQIANTCGICSRAYAPYI