Identifiers and Description

Gene Model Identifier

TTHERM_00532590

Standard Name

CMK2  (CalModulin dependent protein Kinase )

Aliases

PreTt19915 | 68.m00204 | 3830.m00569

Description

calcium-dependent kinase; Calmodulin-dependent protein kinase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11862.1 9.997093137033517e-262
Description: protein kinase domain-containing protein (1450 aa)
Oxytricha Contig22243.0.g46 3.0009023271667765e-140
Description: Protein kinase domain
WormBase WBGene00006779 3.9983507938127826e-75
Description: locus:unc-43 Calcium/calmodulin-dependent protein kinase type II status:Confirmed UniProt:O62305 protein_id:CAC42322.1
DictyBase DDB_G0279925 4.99966753182923e-69
Description: mlkA on chromosome: 3 position 2752719 to 2754560
SGD YOL016C 5.002115178225629e-63
Description: CMK2 Calmodulin-dependent protein kinase; may play a role in stress response, many CA++/calmodulan dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to Cmk1p and mammalian Cam Kinase II
Stentor Coeruleus SteCoe_6505 7.868448159078602e-63
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00532590(coding)
ATGGGTTGCTGCCAATCGCAAGACTAAGAACATGAAAAAAATATTGAAGACAAAATTCAT
GGTAGGCAAGGAAAAGTGATTAGCTAAGATAACGATAGAGAATAAAATTCTGATACATAT
GAGAAAGATTATGAAAAAAACTAAGTAGCTAAGTAATAAAAAGCAATCAATAGCTAATAG
GGTATAAGCTCCTCTACCAAAGAGTAGACTAATGGTAGTACAGCTAATGAAAAGAATACA
GCAGTCAGCAAATAGAATAGTAAGCATTCATCCTCAATAACTGATATACCACAAAAAGTA
GAAAAGCAAAGCTAGCCAAATGGAGTGAATCCTATTAGTTTTGCAACTCAAAAATCAGAT
TAAAAGTAAAATGTATCTGAAGACTTTAAGATTTAGAAAAATATGGTTAGAATAAGCACA
TAAGATATATTAGACAGCTATACAATAGGAAAAGTTATAGGTGAAGGTGGATTTGGTACT
GTGTGTCTTGTTAGGCATAAAACTACTCAAATAGATAGGGCTATGAAGATGATTCCTAAA
AAAAAGCTTAATAAATCAGATGAGGATAAATTATTTGAAGAGCTAGCTATTCTGAGATAA
ATTGATCACCCATGTATTGTAAAAGTATTCGAGCACTTCTAAGATGAAAAATATCACTAT
CTTATTTCTGAATATTGTACAGGAGGTGAACTTTTTGAAAGAATTAAGGACGTCAGCCCA
TTTACTGAAAAAGTTGCTGCTGGCTATATGAAGCAAATTTTATCAGCTATATCATATTGT
CATATTAATAATATTGTCCATCGTGATTTGAAGCCTGAAAATATTTTGTTTGACTCTAAG
GCAACTAACAGCAATCTTAAAGTCATCGATTTTGGTGCTTCAACTAAATTCGATCATAAT
GAAAAGCTTACAAAAAGAATTGGTACTCCATTTTATGTAGCTCCAGAAATTTTAACAAAA
AAGCCTTATGATGAAAAATGCGATGTGTGGTCTTTAGGTGTTATAATGTACATTCTTCTT
TGTGGATATCCTCCATTTTGGGGTTAAACTGACTAAGAAATATATGAAAAGGTTAAAAAA
GGAAAATTTGAATTTTATGATGAGGATTGGGCTGATAGATCTAGTGATGCCAAAGATTTA
ATTTCAAAGATGCTTTAGTATGATCCCAAAGATAGAATTTCAGCAACAGAAGCATATGCT
CATCCATGGATTTTGAGTAATGTTCATGTAGAGCCTCTTGATGATAAAATGATGAAAAAA
CTTTCTTAATTTGCTGCAAAGAATAAACTAAGAATAGCAATTTTAAATTTAATGGCAAAT
CAGGTGTTAAATACTTAAGATAAAATAGAATTAGTTAAGCATTTCGAGTCTCTTGATACT
AATGGAGATGGTATGCTTTCCAAAGAAGAATTAATCGAGGGTTACACAAAACTTTTAGGA
GACTAACTTAAAGCAAAGCAAACTGTAGAAAATGTTTTTAATGATTTAGATTTGGATGGT
TCTGGAAAAGTTGAGTTTTCAGAATTTTTGGTTGCTTGCTTGCAAAAGGAAAAAGTTTTA
ACAAAGGATAGAATTGAAAAAGCATTTAAATTGATAGATACAGATGGAAACGGTCAGATT
ACAAAGAAAGAACTTGAAGAAATGATGGGAGGCCTTCCATTAAATGAGAAAGTTTGGGAG
AGTCTCTTGAAAGATTGTGATGTCAATTAAGATGGATAAATTTCACTTACAGAATTTTTG
GACTTACTTCTAAATGCCAAGGAGTTATTTAATTTATGA


>TTHERM_00532590(gene)
ATGGGTTGCTGCCAATCGCAAGACTAAGAACATGAAAAAAATATTGAAGACAAAATTCAT
GGTAGGCGTAATATTTGAATTACTTTAACATAGATATTTACTACTCATTAATTCCTCTTC
TGCTGATTTTTCATATTTATCTAAATTATTCTCATAGCAATCAAAAATAAGCATAATATT
TCCTAAAATATATGAATAGATGATTAATTGTTGAATTTAAAGAGAGGTATATACCTTATT
TTGATGCTAATTATTTTTTAGATAAATACGAAATAAGATTTCTTTTGCTTGAATTATTTT
TAAATTGCAGCAATCCCACCAAACTCATCAAATTATGAATCTATTTAATTTAGTCTATTA
TATTAGAAATAATACAACGTTTATAGTTTAAAGATAAATTAGAATATGAACTCTTATTTT
ATATAAAAGAAGGAAAAGTGATTAGCTAAGATAACGATAGAGAATAAAATTCTGATACAT
ATGAGAAAGATTATGAAAAAAACTAAGTAGCTAAGTAATAAAAAGCAATCAATAGCTAAT
AGGGTATAAGCTCCTCTACCAAAGAGTAGACTAATGGTAGTACAGCTAATGAAAAGAATA
CAGCAGTCAGCAAATAGAATAGTAAGCATTCATCCTCAATAACTGATATACCACAAAAAG
TATGTTAATTTTAAAAGACTTTAATTAAATAAATGAAGTTTATTTAGGAAACACTACTTG
AATTTTATATCGATAGTTATTTTTTTTTGTTTTTTGGCTTTAATTTTATCAAGTTAGTAA
GCAAGTGCTATTATTGCCTAGGATTATTTTTTTTTACCTGGCTTCATTACAATTTAATAA
AATATTTTAATATTTGAATTATCATTTTATAAATAGGTAGAAAAGCAAAGCTAGCCAAAT
GGAGTGAATCCTATTAGTTTTGCAACTCAAAAATCAGATTGTATTTATATTATTTTTTAG
CTATTTCTCTTTAATTTTTGCGCAAAAAAACTACTTTGAGTAACAAAAATATTTATAAAT
AAATAATAGAAAAGTAAAATGTATCTGAAGACTTTAAGATTTAGAAAAATATGGTTAGAA
TAAGCACATAAGATATATTAGACAGCTATACAATAGGAAAAGTTATAGGTGAAGGTAATC
AATCAGTCAATTATTTTGCCAATTTATGCTGTTAAAAAATGGCTTAAAATATTTTTAGCA
ATCAACACATTAGAATGAATGTTCAATAAATAAAAATTATTTTCTTGTAATATCAATAGG
TGGATTTGGTACTGTGTGTCTTGTTAGGCATAAAACTACTCAAATAGATAGGGCTATGAA
GATGATTCCTAAAAAAAAGCTTAATAAATCAGATGAGGATAAATTATTTGAAGAGCTAGC
TATTCTGAGATAAATTGATCACCCATGTATTGTAAAAGTATTCGAGCACTTCTAAGATGA
AAAATATCACTATCTTATTTCTGAGTAATACAAATTTATTTATTTGGTTTTATTTTTTCA
TCAAAACAAAAACTCAAGTGAGTAAGTACATTTGATTTTTATAAAAAACAATGCTAACAT
AAATAAATAAATCATTAAGAATTTTATTTTCTTAGTTATTATTAGGATTATTGTAGCCTA
AATTTATTTATTTATTTGAACATTTAAAAACGTTATTAATTAAAATGCTAAAATAAATTG
AGCAATAAAATTAATTAACAGAAATTTGTTTTTTACTAAAATTAAAAACAAGATCAGTAA
AAATTAACCACACATTTTTATTTAAAACAGATATTGTACAGGAGGTGAACTTTTTGAAAG
AATTAAGGACGTCAGCCCATTTACTGAAAAAGTTGCTGCTGGCTATATGAAGCAAATTTT
ATCAGCTATATCATATTGTCATATTAATAATATTGTCCATCGTGATTTGAAGCCTGAAAA
TATTTTGTTTGACTCTAAGGCAACTAACAGCAATCTTAAAGTCATCGATTTTGGTGCTTC
AACTAAATTCGATCATAATGAAAAGCTTACAAAAAGAATTGGTACTCCATTTTATGTAGC
TCCAGAAATTTTAACAAAAAAGCCTTATGATGAAAAATGCGATGTGTGGTCTTTAGGTGT
TATAATGTACATTCTTCTTTGTGGGTAATGGATATATTTTATCAATTTTATTTGATGTAA
TAATTATGAATTTTAAAATAAAGATATCCTCCATTTTGGGGTTAAACTGACTAAGAAATA
TATGAAAAGGTTAAAAAAGGAAAATTTGAATTTTATGGTAATTTATTTGTAGCAATAAGC
AATAGTAAAAAAATTATTTATAAAAAGATGAGGATTGGGCTGATAGATCTAGTGATGCCA
AAGATTTAATTTCAAAGATGCTTTAGTATGATCCCAAAGATAGAATTTCAGCAACAGAAG
CATATGCTCATCCATGGATTTTGAGTAATGTTCATGTAGAGCCTCTTGATGATAAAATGA
TGAAAAAACTTTCTTAATTTGCTGCAAAGAATAAACTAAGAATAGCAATTTTAAATTTAA
TGGCAAATCAGGTGTTAAATACTTAAGATAAAATAGAATTAGTTAAGCATTTCGAGTCTC
TTGATACTAATGGAGATGGTATGCTTTCCAAAGAAGAATTAATCGAGGGTAAACCATTTT
CTATGAGTTAAAAATGCTTATTTATATATATTTATTTAAATAATTAAAAAAAGGTTACAC
AAAACTTTTAGGAGACTAACTTAAAGCAAAGCAAACTGTAGAAAATGTTTTTAATGATTT
AGATTTGGATGGTTCTGGAAAAGTTGAGTTTTCAGGTAAAATATTTATATCAAAATATAA
ACAAAAAATTTTATTGAAATAAATTTAATTAAATTAGAATTTTTGGTTGCTTGCTTGCAA
AAGGAAAAAGTTTTAACAAAGGATAGAATTGAAAAAGCATTTAAATTGATAGATACAGTA
AAAATTATTTTTAAAGAGAATTAATTCTCAAGCAATTTATTTAATATAGGATGGAAACGG
TCAGATTACAAAGAAAGAACTTGAAGAAATGATGGGAGGCCTTCCATTAAATGAGAAAGT
TTGGGAGAGTCTCTTGAAAGATTGTGATGTCAATTAAGATGGATAAGTATTTTTTTTTGT
TTTTGTAAATGCTTTATTTTATTAATAATTTTATGAAATAGATTTCACTTACAGAATTTT
TGGACTTACTTCTAAATGCCAAGGAGTTATTTAATTTATGA


>TTHERM_00532590(protein)
MGCCQSQDQEHEKNIEDKIHGRQGKVISQDNDREQNSDTYEKDYEKNQVAKQQKAINSQQ
GISSSTKEQTNGSTANEKNTAVSKQNSKHSSSITDIPQKVEKQSQPNGVNPISFATQKSD
QKQNVSEDFKIQKNMVRISTQDILDSYTIGKVIGEGGFGTVCLVRHKTTQIDRAMKMIPK
KKLNKSDEDKLFEELAILRQIDHPCIVKVFEHFQDEKYHYLISEYCTGGELFERIKDVSP
FTEKVAAGYMKQILSAISYCHINNIVHRDLKPENILFDSKATNSNLKVIDFGASTKFDHN
EKLTKRIGTPFYVAPEILTKKPYDEKCDVWSLGVIMYILLCGYPPFWGQTDQEIYEKVKK
GKFEFYDEDWADRSSDAKDLISKMLQYDPKDRISATEAYAHPWILSNVHVEPLDDKMMKK
LSQFAAKNKLRIAILNLMANQVLNTQDKIELVKHFESLDTNGDGMLSKEELIEGYTKLLG
DQLKAKQTVENVFNDLDLDGSGKVEFSEFLVACLQKEKVLTKDRIEKAFKLIDTDGNGQI
TKKELEEMMGGLPLNEKVWESLLKDCDVNQDGQISLTEFLDLLLNAKELFNL