Identifiers and Description

Gene Model Identifier

TTHERM_00535270

Standard Name

CYC34 (CYClin 34)

Aliases

PreTt03112 | 69.m00154 | 3718.m00016

Description

amine-terminal domain cyclin

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11224.1 4.997699094967085e-82
Description: hypothetical protein (201 aa)
DictyBase DDB_G0280425 1.9991095569230066e-20
Description: DDB_G0280425 on chromosome: 3 position 3332494 to 3333718
SGD YIL050W 8.002082816694397e-20
Description: PCL7 Pho85p cyclin of the Pho80p subfamily, forms a functional kinase complex with Pho85p which phosphorylates Mmr1p and is regulated by Pho81p; involved in glycogen metabolism, expression is cell-cycle regulated
Oxytricha Contig20637.0.g110 0.0000000000005000841553255702
Description: Cyclin
WormBase WBGene00022697 0.000009999254677478949
Description: locus:cyy-1 Uncharacterized cyclin-like protein ZK353.1 status:Partially_confirmed UniProt:P34624 protein_id:CCD73200.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64

Sequences

>TTHERM_00535270(coding)
ATGCAAAGAAGAGAAATGACCGCTATGACTCAAAATAAATCTGAAACCCAAGAATCCGTC
AAATAGTGTGGTAACTAAAAGGATATCTTGAAGTCAGAAGAAATCATGAGTCAAAATCCC
ATGTTGGACAATACCTCTGATGGTGAAAAAGTTGAAAAATCAATCAACTTACAAGCCATA
GCCGAATATCTCGAGCAAATTGCTCGTTAATAGGATGCTGAATAAGCTGTTCCTCACCCA
ACATTCGCTGCTAAAAAATTGCCTCCCATCTCCATTATGGACTACTTAAAGAGACTCCAA
AAATTCACCGATTGCTCAAATGCTAATTTCGTATTAGCTTTGATTTATATCGAGAGACTC
CAAGAAAGTATGGGAGAGATTCTTTTGAATTCATACACCATCTTGAGATTAATTTTGGCC
TCTACTATCATCGCTATCAAATACAACTACGACTAAACCTTGAAGAACGACTACTACGCC
AAGATTGGAGGAGTCAAGAAGGAGGAACTTAACGAACTCGAAGCTGCTTTCTGCGAAATG
ATGGACTTCAGATTATACGTTAGTGACGAAACCTTTGAAAACTACGTTAACCAATTCTCT
TTCTGA


>TTHERM_00535270(gene)
ATGCAAAGAAGAGAAATGACCGCTATGACTCAAAATAAATCTGAAACCCAAGAATCCGTC
AAATAGTGTGGTAACTAAAAGGATATCTTGAAGTCAGAAGAAATCATGAGTCAAAATCCC
ATGTTGGACAATACCTCTGATGGTGAAAAAGTTGAAAAATCAATCAACTTACAAGCCATA
GCCGAATATCTCGAGCAAATTGCTCGTTAATAGGATGCTGAATAAGCTGTTCCTCACCCA
ACATTCGCTGCTAAAAAATTGCCTCCCATCTCCATTATGGACTACTTAAAGAGACTCCAA
AAATTCACCGATTGCTCAAATGCTAATTTCGTATTAGCTTTGATTTATATCGAGAGACTC
CAAGAAAGTATGGGAGAGATTCTTTTGAATTCATACACCATCTTGAGGTAAAAGAGGATT
CATTCTGCAAAAAATCCACATATAACTCCTATATAAAATCAATTCGTTGCAAAAAATATT
TCCACACTATAAAAAAAAAATCAAAAAAATGCGCGAATTTTCCCTTCAAAATATGAAGGA
GGGGGTTAAAAGTGGTAGCCAACATAATCGAATGAAAAAGAGAAATATAACGGTCCAATT
CTCACTTGAAAATTGCAAAGAAACAAATTTTTTCTTAAATGCAATTCAAGATACGAAAAA
TAAGAGATGATGGGTAACAAAAAGCAAAGTCTTTATAAATGTTTACATCAATCACCTTCC
TTATTTATTTGAGAAAGAAATGAAACTCGAAACAAAACAAAAAAAATCAAATAATGAACG
AGCAGGACGTTCCTGTAATAGAAAATTACAATTTGATTTAAAACGATGTTTCAAATAAAA
GGATCGCTTTCCTTCTTCATGAAGATGGATATCACGAAAACCTTTCAAAATTTTTACTTT
ATTTTTAAATTAATATTTTTATGGAAAGATACGAATACTTTTGAGATAAAAAGATAGATA
TAATATTTCCCTTCAAATTATTAATTTTGTTTTCTTTTTTATTAGATTAATTTTGGCCTC
TACTATCATCGCTATCAAATACAACTACGACTAAACCTTGAAGAACGACTACTACGCCAA
GATTGGAGGAGTCAAGAAGGAGGAACTTAACGAACTCGAAGCTGCTTTCTGCGAAATGAT
GGACTTCAGATTATACGTTAGTGACGAAACCTTTGAAAACTACGTTAACCAATTCTCTTT
CTGA


>TTHERM_00535270(protein)
MQRREMTAMTQNKSETQESVKQCGNQKDILKSEEIMSQNPMLDNTSDGEKVEKSINLQAI
AEYLEQIARQQDAEQAVPHPTFAAKKLPPISIMDYLKRLQKFTDCSNANFVLALIYIERL
QESMGEILLNSYTILRLILASTIIAIKYNYDQTLKNDYYAKIGGVKKEELNELEAAFCEM
MDFRLYVSDETFENYVNQFSF