Identifiers and Description

Gene Model Identifier

TTHERM_00537240

Standard Name

MPK11 (Mitogen-activated Protein Kinase)

Aliases

PreTt03210 | 69.m00252 | 3718.m00113 | XP_001023534

Description

extracellular response kinase; Protein kinase domain containing protein. Sequence similarity to the ERK7 subfamily of the protein kinase MAPK family (Eisen et al.- 2006); Putative mitogen-activated ERK7 subfamily (MAP) kinase (Yildiz & Arslanyolu- 2014)

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF03276 ) spumavirus gag protein
  • ( PF06293 ) Lipopolysaccharide kinase (Kdo/WaaP) family
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Oxytricha Contig194.1.g74 2.000147820282363e-173
Description: Protein kinase domain
Tetrahymena borealis EI9_04020.1 5.998685392774004e-165
Description: protein kinase domain-containing protein (769 aa)
DictyBase DDB_G0283903 9.003513400998346e-160
Description: erkB on chromosome: 4 position 1385123 to 1386548
WormBase WBGene00015478 3.000615301710693e-133
Description: Putative serine/threonine-protein kinase C05D10.2 status:Confirmed UniProt:Q11179 protein_id:CCD63173.1
SGD YBL016W 9.998074580622396e-81
Description: FUS3 Mitogen-activated serine/threonine protein kinase involved in mating; phosphoactivated by Ste7p; substrates include Ste12p, Far1p, Bni1p, Sst2p; inhibits invasive growth during mating by phosphorylating Tec1p, promoting its degradation
Stentor Coeruleus SteCoe_37910 1.3485799642996046e-77
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25286252: Yıldız MT, Arslanyolu M (2014) In silico identification and characterization of the MAPK family members of unicellular model eukaryote Tetrahymena thermophila. European journal of protistology 50(5):538-50
  2. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00537240(coding)
ATGAGTGAAGACATAGAACCACATGTTCTAAGAAGATATGAAATATTGAGCAAGCTAGGT
AGAGGAGCATATGGAATAGTTTGGAAAGTATATGACAAAAGGACTAAGCAAGTTTTAGCT
CTAAAGAAAATATTTGATGCGTTTCAGAATTCAACTGATGCATAGCGTACCTTTAGAGAG
ATTATGTTTCTCTAAGAATTAGATCATGAAAATATAATTAAAGTGATTAATGTAATTCGT
GCAAAGAATGACCGTGATATTTATGTAGTTTTTGAATATATGGACACTGATTTGCACGCG
GTTATTAGGGTTAACATTCTTGAAGATATTCATAAATAATATATAATGTACTAAATATTT
AGAGCAATAAAGTACATACACTCTGGTGAGTTAATTCATAGAGACTTAAAAGCATCAAAT
ATCCTTGTAAATTCAGATTGTATGGTGAAAGTAGCAGATTTCGGATTAGTAAGATCGATT
GCGAACTAAGAAAACGGCTCAACTCCAATACTCACAGAGTATATAGCCACAAGATGGTAT
AGGGCACCAGAAATATTATTAGGTTCACATACGTATACCAAGGGAGTAGATATGTGGAGT
ATTGGCTGTATTTTGGGATAGCTTTTATTAGGAAAGCCTATCTTTGCAGGAACAAGCACT
CTCAATTAACTTGAATTAATATTATAAGTTACTGGTAAACCAACGTACGAAGATATTGAA
GCTATTTAGAGCGATTTAGCAATAACTATGCTAGAAGCTGTATAAAATAATCCAACTTAA
AATACCAAAACTCTCCAGTAAATGATACCAATGGCCAGTGATGATGCTTTAGATCTATTA
TAAAATTTACTTTAGTTTAATCCAAAAAAGCGTATAACTGCAGAATAGGCTTTAAGTCAT
CCATACGTTAGGTAATTCCATAATCCTAATGATGAGCCTGTTTGTGGAAGAATCATTTAA
ATTCCGTTAGATGATAATAAAAAATATAGTATGAGATTTTATAGAGATAAATTATACTAT
GAAATATCTCCAAGAAAAAATGTTTAGCAGAATGGTAAGTAGGATTCTTAATTATGCAGT
AATTTTTCAGAATCATAAGATTAGATTTAATAGCCGCAGTAAATATAGCATTAATAATAA
ACAGTAAATGAGTAATAAGTCCTTCAGTAAAGAACAAATAATTAACAATTTTAGTCAAAA
GATAATTCAATTCAAAATGCTAGAAACAACTCAAACAGTTCTAATTCAAGCTAAGTGAAA
ACAAATTAATCTACTTACAATAATATTTAATCTACACTTTTAAGATAAAAATCAAATGGG
ATAATTTAAAAGTAAGAAAATGGAAATATGTAATAAAATTAGAATATTTAAAGTTCAGAT
TAACAATAGAATTTAGCAAAGGAAGTTATTTAATAAACATCAGCTGTAGTTGCTGCGTAG
TAAGCAGTATTAGCTCGAAAGACATAGAAATAAAATAGTATATAATTTTAGCAAAATATT
TACAACGAAGTGTAAGAAAGCATATATCAATAAGTAAAAACATAAAAGCAATAGCTTTAT
CAGTAATAGCTGATGCAATAATAGTAACAGTAATAATAAAAAATGTAATAACAATCCTAA
AATTAAGTTATCAGTAGTAAAAATTAAATTCAATATCAATCAAGTAATATAAATAAAAAG
TAAAATGAAGAAAATGAAATTAGAGATCCTTCAGAAAACAGTATCAAGCAATAATAGAAA
CTCTATGCATCCCCAAAAGCTCCAAGTTCAAATTAAATTTTATCAAATAATTAAAATTTG
TAATAAACCTTAACAAATAATATCATGAGTACAAATAATACAAATGGAATTCACAATACA
ATTAGTAATGGTTTCGCTAAAAGACCAACTCCTTTCTTATAGAGTAAGAATAGCAGTTAA
TAAACTTCAAATTCTACTGCACTAAACCAAAAAAGTTCCTCAAATTAAAATTCTTAATAA
ATTCTATAATAACAGTAAGTAAAATAAATGCTTAATAGTCCTAACACTTAACAGATGATA
TAACAATAGAAAAGTAAGGAAATAAATTAAAATATTTTCAGTTAACAAAATATTTAAAAT
CCTCATTTGCTCAATGGAAATCAATATATTAGCAGCAACAATACAATTAACAACAATAAT
GATGGATAAATTGATAATGTTGATGAAGGAATTACATCTCCAGTAAGTTAAAATATATTA
AAGTAATCGAATAGTAATAGATTGATTAAGCCTAATAATCTGAAATCTAATTCAAGTAAA
GCTCTGTAATCGCCAACCTCAAATATAGTATCTCCATAGCATTAATAGTAATCTTCTGTA
AGCTCCTAATCCACTTAATAGTCGCACCCCTCTTCAGCAATTTAAAATTAAAACTCTTAA
GTATAACAAAAACCAGCTTCAATAAACACTTCTTAAAAATATTTGTAAAGAATTATATAG
GGAGCAACACCTTCTACATAGCAAGAGAATAATTTAAAATAAGCCATTTCACATTAAAAT
CAAAATAATATAATACAATAATAATATTAGAATTATATCAACAGCAATTTAAGTACAAAT
AACAACAACAGTAACCCAAGTCATTAAATGAATAATTAGAATGTTTAAAATACAAATGTT
CAGTCATAAAGCAATGGATACTCCTAAAACAATAACGGGTACCCTACTTAAAGTAATAGT
GGATATTAGCAATTAAACAATGGATATCCATAACATACCAATATATATTCATAGAATAGT
AGCAATAATATATATACTTAACAATAGCAACAGCAATTATCTGGACAATTAAAGAAAGGA
TCTACTTCTATTAATTAATATCTTACAACAACTTATAAAAACCCTACCTAAACAATGTAA
TAATAAATGTATAAAGGAAATCAAATAGATTTTTATTCTCCGAACAAATCGAAAGTTAAC
ACTGCAAATTATTTTGGTAATAGGGCTTCGGTAACAAAAACTATGGCCTAATTAAACCAA
AAGAATAATAGCAATAGTGCTATAATTCCAAACTCTAACACAAGCAATTAAATTTAAAAT
AATAATTAATTAAATACAAATAATAACAATAATAGCAATAAAAACTATTAAACAGGCTAA
AATGGGCATATTATTTTGAATGGTAATCAATCTGTTTCTCATAATATTCATGCATAGAAT
AGCGTATCTGCAGGGAATATGGCTAACAACAATTTAAATTCTCTTAATGGCTAGTCTTCT
ACAAAAAATAAATATAGCTATTCTAATCTTTTATAAAATGCTTAAAAATTAAAGGCAAAT
ACTCCTTCCTATCATTAACTTAATTCTCCTAAGTATTGA


>TTHERM_00537240(gene)
ATGAGTGAAGACATAGAACCACATGTTCTAAGAAGATATGAAATATTGAGCAAGCTAGGT
AGAGGAGCATATGGAATAGTTTGGAAAGTATATGACAAAAGGACTAAGCAAGTTTTAGCT
CTAAAGAAAATATTTGATGCGTTTCAGAATTCAACTGATGCATAGCGTACCTTTAGAGAG
ATTATGTTTCTCTAAGAATTAGATCATGAAAATATAATTAAAGTGATTAATGTAATTCGT
GCAAAGAATGACCGTGATATTTATGTAGTTTTTGAATATATGGACACTGATTTGCACGCG
GTTATTAGGGTTAACATTCTTGAAGATATTCATAAATAATATATAATGTACTAAATATTT
AGAGCAATAAAGTACATACACTCTGGTGAGTTAATTCATAGAGACTTAAAAGCATCAAAT
ATCCTTGTAAATTCAGATTGTATGGTGAAAGTAGCAGATTTCGGATTAGTAAGATCGATT
GCGAACTAAGAAAACGGCTCAACTCCAATACTCACAGAGTATATAGCCACAAGATGGTAT
AGGGCACCAGAAATATTATTAGGTATTATTGAGTTATCACAATGTTAAGATTTAAAATGA
AAAGTTTTAGATAAATTAATAAAATGCTAACTAAAAAATATGAAGATAAATTACATTTGA
AAATTAATAAAATATTAGCTTTTTAAAAATGAATGAAATCTTTAAGTGTGTTTTTTTTTT
TTTTTTAATTTGCAGGCATTCAATTAATTTAGAGTAGAAAGCTAGAAAAAGAAATTGCAG
AATGAAAAATATTTAATTTTTTAAATTGTTTGATAAAAAAAAATTAATTCTTAAGAGAAA
TAAATGAATGACTCTGTTGTTTTTAATATTTGAAAAAGCAAAGATAAATAGAAAATCTTC
ATTCATTTGTAATCAAAATAAAGCAAAGCTAATTAACAAAATAATCAGTCATATGTTAAA
AAAAACAAGAAATCAATAAATAAATCTAATTACTCTTTTTTAAATTTAAACTATAAAACG
ATATGTTGTAGCATCCTTTAAATTTATTAAAATAAATACATAAGCTATATTAAATTCATT
TTCTACTCATTAAATAATAAATAAATTTATTAATAAATTTAAAATTCATTTCTTTTAATA
TTTTTTATGAATATATTTATTTAAATTACTCATAATTTTATTATGAATATTATTAAAGGT
TCACATACGTATACCAAGGGAGTAGATATGTGGAGTATTGGCTGTATTTTGGGATAGCTT
TTATTAGGAAAGCCTATCTTTGCAGGAACAAGCACTCTCAATTAACTTGAATTAATATTA
TAAGTTACTGGTAAACCAACGTACGAAGATATTGAAGCTATTTAGAGCGATTTAGCAATA
ACTATGCTAGAAGCTGTATAAAATAATCCAACTTAAAATACCAAAACTCTCCAGTAAATG
ATACCAATGGCCAGTGATGATGCTTTAGATCTATTATAAAATTTACTTTAGTTTAATCCA
AAAAAGCGTATAACTGCAGAATAGGCTTTAAGTCATCCATACGTTAGGTAATTCCATAAT
CCTAATGATGAGCCTGTTTGTGGAAGAATCATTTAAATTCCGTTAGATGATAATAAAAAA
TATAGTATGAGATTTTATAGAGATAAATTATACTATGAAATATCTCCAAGAAAAAATGTT
TAGCAGAATGGTAAGTAGGATTCTTAATTATGCAGTAATTTTTCAGAATCATAAGATTAG
ATTTAATAGCCGCAGTAAATATAGCATTAATAATAAACAGTAAATGAGTAATAAGTCCTT
CAGTAAAGAACAAATAATTAACAATTTTAGTCAAAAGATAATTCAATTCAAAATGCTAGA
AACAACTCAAACAGTTCTAATTCAAGCTAAGTGAAAACAAATTAATCTACTTACAATAAT
ATTTAATCTACACTTTTAAGATAAAAATCAAATGGGATAATTTAAAAGTAAGAAAATGGA
AATATGTAATAAAATTAGAATATTTAAAGTTCAGATTAACAATAGAATTTAGCAAAGGAA
GTTATTTAATAAACATCAGCTGTAGTTGCTGCGTAGTAAGCAGTATTAGCTCGAAAGACA
TAGAAATAAAATAGTATATAATTTTAGCAAAATATTTACAACGAAGTGTAAGAAAGCATA
TATCAATAAGTAAAAACATAAAAGCAATAGCTTTATCAGTAATAGCTGATGCAATAATAG
TAACAGTAATAATAAAAAATGTAATAACAATCCTAAAATTAAGTTATCAGTAGTAAAAAT
TAAATTCAATATCAATCAAGTAATATAAATAAAAAGTAAAATGAAGAAAATGAAATTAGA
GATCCTTCAGAAAACAGTATCAAGCAATAATAGAAACTCTATGCATCCCCAAAAGCTCCA
AGTTCAAATTAAATTTTATCAAATAATTAAAATTTGTAATAAACCTTAACAAATAATATC
ATGAGTACAAATAATACAAATGGAATTCACAATACAATTAGTAATGGTTTCGCTAAAAGA
CCAACTCCTTTCTTATAGAGTAAGAATAGCAGTTAATAAACTTCAAATTCTACTGCACTA
AACCAAAAAAGTTCCTCAAATTAAAATTCTTAATAAATTCTATAATAACAGTAAGTAAAA
TAAATGCTTAATAGTCCTAACACTTAACAGATGATATAACAATAGAAAAGTAAGGAAATA
AATTAAAATATTTTCAGTTAACAAAATATTTAAAATCCTCATTTGCTCAATGGAAATCAA
TATATTAGCAGCAACAATACAATTAACAACAATAATGATGGATAAATTGATAATGTTGAT
GAAGGAATTACATCTCCAGTAAGTTAAAATATATTAAAGTAATCGAATAGTAATAGATTG
ATTAAGCCTAATAATCTGAAATCTAATTCAAGTAAAGCTCTGTAATCGCCAACCTCAAAT
ATAGTATCTCCATAGCATTAATAGTAATCTTCTGTAAGCTCCTAATCCACTTAATAGTCG
CACCCCTCTTCAGCAATTTAAAATTAAAACTCTTAAGTATAACAAAAACCAGCTTCAATA
AACACTTCTTAAAAATATTTGTAAAGAATTATATAGGGAGCAACACCTTCTACATAGCAA
GAGAATAATTTAAAATAAGCCATTTCACATTAAAATCAAAATAATATAATACAATAATAA
TATTAGAATTATATCAACAGCAATTTAAGTACAAATAACAACAACAGTAACCCAAGTCAT
TAAATGAATAATTAGAATGTTTAAAATACAAATGTTCAGTCATAAAGCAATGGATACTCC
TAAAACAATAACGGGTACCCTACTTAAAGTAATAGTGGATATTAGCAATTAAACAATGGA
TATCCATAACATACCAATATATATTCATAGAATAGTAGCAATAATATATATACTTAACAA
TAGCAACAGCAATTATCTGGACAATTAAAGAAAGGATCTACTTCTATTAATTAATATCTT
ACAACAACTTATAAAAACCCTACCTAAACAATGTAATAATAAATGTATAAAGGAAATCAA
ATAGATTTTTATTCTCCGAACAAATCGAAAGTTAACACTGCAAATTATTTTGGTAATAGG
GCTTCGGTAACAAAAACTATGGCCTAATTAAACCAAAAGAATAATAGCAATAGTGCTATA
ATTCCAAACTCTAACACAAGCAATTAAATTTAAAATAATAATTAATTAAATACAAATAAT
AACAATAATAGCAATAAAAACTATTAAACAGGCTAAAATGGGCATATTATTTTGAATGGT
AATCAATCTGTTTCTCATAATATTCATGCATAGAATAGCGTATCTGCAGGGAATATGGCT
AACAACAATTTAAATTCTCTTAATGGCTAGTCTTCTACAAAAAATAAATATAGCTATTCT
AATCTTTTATAAAATGCTTAAAAATTAAAGGCAAATACTCCTTCCTATCATTAACTTAAT
TCTCCTAAGTATTGA


>TTHERM_00537240(protein)
MSEDIEPHVLRRYEILSKLGRGAYGIVWKVYDKRTKQVLALKKIFDAFQNSTDAQRTFRE
IMFLQELDHENIIKVINVIRAKNDRDIYVVFEYMDTDLHAVIRVNILEDIHKQYIMYQIF
RAIKYIHSGELIHRDLKASNILVNSDCMVKVADFGLVRSIANQENGSTPILTEYIATRWY
RAPEILLGSHTYTKGVDMWSIGCILGQLLLGKPIFAGTSTLNQLELILQVTGKPTYEDIE
AIQSDLAITMLEAVQNNPTQNTKTLQQMIPMASDDALDLLQNLLQFNPKKRITAEQALSH
PYVRQFHNPNDEPVCGRIIQIPLDDNKKYSMRFYRDKLYYEISPRKNVQQNGKQDSQLCS
NFSESQDQIQQPQQIQHQQQTVNEQQVLQQRTNNQQFQSKDNSIQNARNNSNSSNSSQVK
TNQSTYNNIQSTLLRQKSNGIIQKQENGNMQQNQNIQSSDQQQNLAKEVIQQTSAVVAAQ
QAVLARKTQKQNSIQFQQNIYNEVQESIYQQVKTQKQQLYQQQLMQQQQQQQQKMQQQSQ
NQVISSKNQIQYQSSNINKKQNEENEIRDPSENSIKQQQKLYASPKAPSSNQILSNNQNL
QQTLTNNIMSTNNTNGIHNTISNGFAKRPTPFLQSKNSSQQTSNSTALNQKSSSNQNSQQ
ILQQQQVKQMLNSPNTQQMIQQQKSKEINQNIFSQQNIQNPHLLNGNQYISSNNTINNNN
DGQIDNVDEGITSPVSQNILKQSNSNRLIKPNNLKSNSSKALQSPTSNIVSPQHQQQSSV
SSQSTQQSHPSSAIQNQNSQVQQKPASINTSQKYLQRIIQGATPSTQQENNLKQAISHQN
QNNIIQQQYQNYINSNLSTNNNNSNPSHQMNNQNVQNTNVQSQSNGYSQNNNGYPTQSNS
GYQQLNNGYPQHTNIYSQNSSNNIYTQQQQQQLSGQLKKGSTSINQYLTTTYKNPTQTMQ
QQMYKGNQIDFYSPNKSKVNTANYFGNRASVTKTMAQLNQKNNSNSAIIPNSNTSNQIQN
NNQLNTNNNNNSNKNYQTGQNGHIILNGNQSVSHNIHAQNSVSAGNMANNNLNSLNGQSS
TKNKYSYSNLLQNAQKLKANTPSYHQLNSPKY