Identifiers and Description

Gene Model Identifier

TTHERM_00537420

Standard Name

FOP1 (FOP amine-terminal 1)

Aliases

PreTt03228 | 69.m00270 | 3718.m00131

Description

Fop amine-terminal dimerization domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

  • positive regulation of natural killer cell tolerance induction (IEA) | GO:0002873
  • pyrimidine ribonucleoside diphosphate metabolic process (IEA) | GO:0009193

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11103.1 9.997093137033517e-262
Description: hypothetical protein (388 aa)
Oxytricha Contig624.1.g115 5.000574419929632e-30
Description: FOP N terminal dimerisation domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00537420(coding)
ATGTAGGAACTTAATGAATTAAAAAATCTTGTGATTTAATCATTGGAAGCTAACGGATCA
TTGAGCAATATTAGAGCTTAAATTAGAGCATCTGTATTTAAAGTTATTGACCAATAAGAT
AACAATTAAGTTTAAAATAAAAAACCCAGTCCTTTCGCTTGGGAAAACCCAAAATGTGCA
AAGTTATTTGAAAGTGAAAGTGGTGTTCTTGCTCTTTAATTGATTAAAGAATTTCTTTAA
TTTTATAACATGGATTACTCTAATAGCGTATTCTCTTCTGAAAGTAATTTAAGGGAAGAA
GTAAAAAGAGACAAAATAAATGAAAAATTATCCTTAAATAAACCAGATGCTTAAAAACCA
TTACTACTCTAATTACTAGAAGAATTTAAATCTGGACGTAGTAGCATGAACTCAAGTGGA
ACTCAATCAGCTGCTCCTAATCCTAATACAGGAGCTTAAAAATAAGAATAAAAAAGTTAA
CAAGAGGGACAAGTCTAAAAAGGTTCTACATAAAGAAGTTAACAAGAGTAATAATAGTAA
CCTCAATAATAATAATAGCAGCTGTAATAATAATAATAACAATAGTAACAATAGCGCTAA
TAACAAGCTAACTACCAAGACTTATTAGGCGATGATGAATTTGAATAATCTCTAGATTCA
TAGAGCGATAATAAGAATTTTTAATCATAGAATAAGCCTATGTCATCTCCTTAAAATGAT
GATAAGAGCGCTTAAAGCTTAGAAAGTACAAGCGAAAAGAAAGCTCTTCAAGAAGCCTAG
TAATTCATTTAAAAAAGTTAAAACTAAATGCGTACTGGACAAATAGGTTCTTTACCAGTT
GGGTAATAATAGTAACAATAATAATAGCAATAACAACAATAATAGTAAAGTGCTGTATAA
TAAAATAAATTTAACGCCAACGTGAAATAATATGAACAAGATTAGTTTGATTAATATGAT
GATGAGATTGAAGGTGTGGAAGAGCAACTTAATGATTACTAAGAAGATATTGATGTAGAT
GACGATATTCTAAACTCAAAAGGAAAGAATGCAGGAGCAAGTAATTAAAGCCATTTTGAA
GAGTCAGAAGACTATATAGGGTAGTCATCAAAGGGTCATGATATTTCAGTTGATTCATAT
GCATTAGAAAACTTTGATTATCTCGAAGATGTTGAAGATTAATGA


>TTHERM_00537420(gene)
ATGTAGGAACTTAATGAATTAAAAAATCTTGTGATTTAATCATTGGAAGCTAACGGATCA
TTGAGCAATATTAGAGCTTAAATTAGAGCATCTGTATTTAAAGTTATTGACCAATAAGAT
AACAATTAAGTTTAAAATAAAAAACCCAGTCCTTTCGCTTGGGAAAACCCAAAATGTGCA
AAGTTATTTGAAAGTGAAAGTGGTGTTCTTGCTCTTTAATTGATTAAAGAATTTCTTTAA
TTTTATAACATGGATTACTCTAATAGCGTATTCTCTTCTGAAAGTAATTTAAGGGAAGAA
GTAAAAAGAGACAAAATAAATGAAAAATTATCCTTAAATAAACCAGATGCTTAAAAACCA
TTACTACTCTAATTACTAGAAGAATTTAAATCTGGACGTAGTAGCATGAACTCAAGTGGA
ACTCAATCAGCTGCTCCTAATCCTAATACAGGAGCTTAAAAATAAGAATAAAAAAGTTAA
CAAGAGGGACAAGTCTAAAAAGGTTCTACATAAAGAAGTTAACAAGAGTAATAATAGTAA
CCTCAATAATAATAATAGCAGCTGTAATAATAATAATAACAATAGTAACAATAGCGCTAA
TAACAAGCTAACTACCAAGACTTATTAGGCGATGATGAATTTGAATAATCTCTAGATTCA
TAGAGCGATAATAAGAATTTTTAATCATAGAATAAGCCTATGTCATCTCCTTAAAATGAT
GATAAGAGCGCTTAAAGCTTAGAAAGTACAAGCGAAAAGAAAGCTCTTCAAGAAGCCTAG
TAATTCATTTAAAAAAGTTAAAACTAAATGCGTACTGGACAAATAGGTTCTTTACCAGTT
GGGTAATAATAGTAACAATAATAATAGCAATAACAACAATAATAGTAAAGTGCTGTATAA
TAAAATAAATTTAACGCCAACGTGAAATAATATGAACAAGATTAGTTTGATTAATATGAT
GATGAGATTGAAGGTGTGGAAGAGCAACTTAATGATTACTAAGAAGATATTGATGTAGAT
GACGATATTCTAAACTCAAAAGGAAAGAATGCAGGAGCAAGTAATTAAAGCCATTTTGAA
GAGTCAGAAGACTATATAGGGTAGTCATCAAAGGGTCATGATATTTCAGTTGATTCATAT
GCATTAGAAAACTTTGATTATCTCGAAGATGTTGAAGATTAATGA


>TTHERM_00537420(protein)
MQELNELKNLVIQSLEANGSLSNIRAQIRASVFKVIDQQDNNQVQNKKPSPFAWENPKCA
KLFESESGVLALQLIKEFLQFYNMDYSNSVFSSESNLREEVKRDKINEKLSLNKPDAQKP
LLLQLLEEFKSGRSSMNSSGTQSAAPNPNTGAQKQEQKSQQEGQVQKGSTQRSQQEQQQQ
PQQQQQQLQQQQQQQQQQRQQQANYQDLLGDDEFEQSLDSQSDNKNFQSQNKPMSSPQND
DKSAQSLESTSEKKALQEAQQFIQKSQNQMRTGQIGSLPVGQQQQQQQQQQQQQQQSAVQ
QNKFNANVKQYEQDQFDQYDDEIEGVEEQLNDYQEDIDVDDDILNSKGKNAGASNQSHFE
ESEDYIGQSSKGHDISVDSYALENFDYLEDVEDQ