Identifiers and Description

Gene Model Identifier

TTHERM_00538800

Standard Name

RRM36 (RNA recognition motif-containing protein 36)

Aliases

PreTt12137 | 70.m00133 | 3728.m00032

Description

RRM36 RNA recognition motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18193.1 9.997093137033517e-262
Description: hypothetical protein (1699 aa)
WormBase WBGene00013270 5.000468829272308e-18
Description: status:Partially_confirmed UniProt:Q9NA71 protein_id:CAB55036.2
Oxytricha Contig16750.0.g70 4.997543945741262e-17
Description: IBR domain
DictyBase DDB_G0289043 0.00000000000003999587784428659
Description: DDB_G0289043 on chromosome: 5 position 2291494 to 2297048
SGD YKR017C 0.000000000000900343533975275
Description: YKR017C Putative protein of unknown function; contains a RING finger motif

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00538800(coding)
ATGTAGCAGCTTTAATAGGAACTCTCTGAACTCATAAACTAATAGGGTTAAGTTCAAGAT
ATACACAGTACATTAACAAGAAACTCTGCTTCTAATAGTATTATAAGAGAAGAAACATTA
CAAAACTATTTGATTTCTGAAAGTAAAGAAAGCCAAGAAAATTTAAAGCATATTATCCAA
AAAAGCAAAATAGATTATTTGTGCAAATTGTAATCAACTTTCACTAGCTCTGAATAAGAA
CAAGAGTTGGCTGAATATATCAAAGATTTCAAAAATAATTTTGGATATCTTGGAAGCGAC
TAAAATAGCCATGTTTGGTAAATTTTATAAAGTTTGAACGAACTTTAATCTGTAAATAGT
GGATTATCATTTATAACAGATAAAAACCCTATTTAGAATGGAGGACTCATTTTTTCTCTT
TTAAAGAGTGCTTTTAATCTTTATCATAAAATTAACTTAGTTAACATATTCGAATCATAA
GCTAGTGAAGACAAGAACTTAAAGCTATAACTAGACGAATAGATGATAGAGACAATTTGG
GACTCCGTTATCGTAAATGGATCCAATAATAAAAAAACTGTTTACTTTTTAAATTTAGAG
TTTTTGAATCCTTCTTAGATTATTTTTATAGCAAAGTTATAGAAACATTTAAATAATTTA
AAAAATGAAGCTTAGATTCCAAATATCGTGATTTACTCTGATGACATTTTAGCATCATAG
CTTAAAGAGTAGATAAAGCCTTAATTAGAAATAGTTTTGGAGTTCAAAAGAATGCCTCAA
AAAATTTAGTATGTATAGAATGCTATTTTATCACAAAAAAGTAAAATGGATTTAATAGAG
CAACTGATAATTGATGCTTTGAAAAAATACAAGCAAACTTTGTTGAGATTTGACGTGCTT
ATATTTGTTAAGAACATTGAAGAGAGCAAATACTTATAGCAACACTATTTAAATCTTATC
AAAGAAAAACTAAATATTATAGATTTGACAGATATTGAAGTGAATGAAGAAGAAAGTAAG
TTTTACTTAGAAGATTTCAAAAAGAATTGGGAAAAATAATTGGTCGAAAAAAAAATAAAA
GAAAAAGAATTAAAAATTTAACAAGAAAAAGAATAGTAGGCCAAGAAAATTGAGGAGGAG
TTAGCACTTGAAAGAGAAAGACAAAGGAAGATTGAAGAAGATAAAAATAAAATATTCGAT
GAAGAAAAAAAACTAATAAAAGAAAAAATAAATCAATAACAAGTATAATAAATACCAGAT
GTTCATCCTTTACAACAAATTAATTAAGATGAACTTAACATTCCTCCTTTCCCTGCTGTT
CCAGAAATATAGCAATAATAGTTAAACTTATAAGAAATATAGATAAATTAAAATTAAGAG
TAAGAGATCTAATTATAGAAAGTACAAAGAGAAGAAGAGATGGTAAAAGAAGAAGAAGAG
TAAAAAAGAAAAGAAGAAGAACTAATGGTAAAAGAAGAAGAAGAGAGAAAAAGAATTGAA
GAAGAAGAAGTGAGAAAAATAAGAGAAGATGAAGAAAACATTAAATTAAAATAATTATAA
GAAGAAGAAGAGAGAAAAAGAAGAGAAGAAGAAGAAATTAAATTAAAAGAAGATGAAGAG
ATAAAAAGAAAGCAAGATGAAGAAAATAAGTTGAAGCAGGAAGAAGAAGAAAGATAAAAA
GATATACAGCAATATAATGAAGATTTAAATAAATAGATTAATAAAAATAAGTAAAATCTC
TACAAAGCAAATGAATTTAATATTTTCATAGCTAAAAGCTATAAGCAATTGAAACATCAT
AACTTAGATAATGTAATCATTTAAATTGATACAGGTGAAGCATTCAAAGTATATTTCATG
GATACTATTTTTGATTAGATTCCTGTAGTAAGCTCTAAAATTACAAGAGAAGAAGCTATT
AAAAGAGAAAGACTCATTGGTAATACTAAATCATGCGAAATTCATAGATTGTATGAAAAA
AAAGAATTCCTTAGACTACAAAAGAGGGATTTTTTGAATTTAATAAATTTGGAATAGTAT
AAGGCCTTTTCAGAAATTTAAAATGAGAAATGCCCTTAAAAGTAAGCAATTAGGATTTTG
TTATAGATCATGATAAATCTTAGTGAAAACTGGTTTAGCTGCTCTTCAGAAGTAGGAGCT
CATATCTCAATTTTATGGAGTAGAATGGGTGATATCTTTTCTGTTCATAACTAGCTCTTG
GTTTCTTAGACTGATGATTTATATTTAGCTTGCTAAAATCTCAATCTGCAGAATATTTTA
GAAAAAAATCAAGTTAATTCAAATCAATATGATAAAATTGTTTATAAAATGCTCAATATT
CAAAAAGTTTTAAATATCAAAGAAGATCCAGTTAAAATCTTACAGAAATTAGAAGCAACC
AAATTTTCAGAACTTGTTCAGTAAGTTGCTATAGAAAAATATTGGAAAAATTTATGCGTT
TATTCAGGACATAGAAGACTTGGTTTCCGTCACTTTGAATCAGCTAAAATGTTGAACTAT
GCTGAAATAAGCAGCATGAACCTTATTTAAGAAAGACCTTTCCTTATTATTCCCCTTCAG
CTTCAAATTAATTCTAAAAATTAATATGAAATAAAGCAATGCTTAGCTATAGATCATCCT
TTTTTACTAGAAAATGCTCCTTCTTAATTTATTGAAAAGCATTAACTCAGACTGCTTAAA
AGACAAAGTTTGAATTTGCATGAGATCGAATATTTTGGTATTTCAGATGCGTTGTTCTAA
TACTTTGAAGATAACAATTAAATAATTAAAGATATGGAAAATAAATTCGATTGTTATTAT
GAGCCTAATCATCATATGGACACTATAACCATACATTCTGATGCAAGCTAAAAGGAAAAA
CTAGAAAAACACTTTAATAACTTGCTTTAAGAAGCATAAAAAATACTCTCAGAAGAAGTT
ATGGAAATTTCACATGGAAACAACTGCATCCTAAAGATTTAAAAAGGAGGTACTATCAAA
GAAGTTACTATTTTACAGAATGAACACATCTTTATTGTTGATAATCTACCCTTAAATGTG
AAAGAGTAAGATGTTATAAATTTATTTGAAGAATATGGAGATATTGTTCAAGTCAAATTT
TTCACTGATCCCACCCTCAAAAATGTTGAAGAAAAATCTATTTCTGCAGAAGTTTTAGTG
GCTGAAACAGAAGATTCCAAATTTTTTGTAGAAACATTTAATTAAATAGAATTTTAAGAT
AGAGTCCTGCAGTTGCGTTTGAAAAACCACAGCTACTAAATACATCAAGATAATAATTCT
ACTAGATATCATAACATTTTTAGATGGCAAACTTGGAAATCAAAACAAACTGGAAGAATT
GAATTTCTTGATGAATCATCAGTTTAATCTTTTATGAAATTAGTTTAAAATAAACTAATT
GTTGATGGTAAGGAAATTAAAGCAGAATAGGATAAAAATTTTAATAAAACCGTCATATTG
AGTGGGCTATAAAAATGCACAGATGAAGAAACTTTAAAATCTTGTTTGATACCAGAACTT
TAAAAGAATATTGTGAGAATAAATGTAGATAGAATAGCTGATGTTGACAGAGGAATTAGC
AAAACTAGTTTAATATTCGCTCTTAATAAGATTTATAAAGAGTAACACTAAATAAGTTGG
GTAAGAAGAAAAGATCATGGTATTGTTGAAGCTAAAATATGCTTTTCTAAAAATTACTTA
TATAAGATGAACACTTACTATGAAAGATTTAATAGTAAGCCAGATATTTTAGGATAATAA
AAATTATATGTTTAAAGAAATTATATTGAAACCTTTAACTATGACTTGAAGATGATGAAC
GTAGTCTAAATGATATTAAAAGGTAATCAGGAATTAGTTTAAATGTAACAAAAGAATGAA
ATAAAACTCAAGGAAAAAATTGTAAGACCAATTCCCTCTAAATAAGAATTCATTGTAATT
TTGAAATGCAATGATGAAACCCACTTTAATAAGGCAAAAGGAATTATGTAAGCTCTGCTT
TAATCAAAACTGCTTGATTTGAGAAATGTAAAATTAGATTTGGCCAGCTTATTCGATGAG
GAAGATTAAGTAGATTACTCTTAGTTGTTCACTGAAATAGGATAAAAGAAGCTCAAAGAA
ATAGAAAGCAAATACCCAGTATTTTTCAAAATAAATTTAATCAAAGAAGAAGTTAGAGTT
TTCTGTACTGATGCCATTTATGATTTGATAAATAAAGATGTTGAGTACTTCTTAAGATAG
AGTGTCAGAGTTAAAATTCCTATTAGTGGAAAAAATATTAGAAACATACTTGGAATAGAT
GGAAGAGGTTTAGAAGAGTTTAAAAATAAAACTAACATTTGCAAAATTTAGCTAGACTAC
ATATCTAAAGACATTTATATGGAAGGTAATTCTAAGTAAGTTGACTAAGCTAAGAATGCT
TTACTTGCTTTATTGGAGGAAAAAAATAGCTAAGCATGCTTAAATAACATGCCTTATTCA
TATGAAGATTGCTAAGTCTGCTCTGACACTATTGTCACAGGATACAGATTGCAAGGCTGT
GGTCATAAATTTTGCCTAAGCTGTATTATGTTTGTAATAGATAATTCTTTAGGTGATGTG
AATTCTCTTCCAATTAAATGTCCTTTTTGCAGTTAAGCTATTATTATGAAAGATATAAAA
ACTCTTATGAGTGAGGATCAAATATAAAAAATGACAAGAATGTCTTTAAATCATTACATA
CAAAACAACTTTTAAGAATTCAGCTTTTGTGTGAATGAAAATTGTAAGTCTATTCATTCA
TCTAAACTAACTAAATATACTTGTTATGAATGCAAAAAAACTTACTGTTCAAAGTGTGCA
GCAGAATATCATTTTGGTATGACTTGTACAGTTTATTAGGAAACTGAAGCGAAAAACATA
GAATTCTTAATCAAAGAAGGTGCTCGTAAATGCCCTAATTGTGGAGTCTACATCATTCGT
ATAGATGGATGTTATAGGGTAGAATGTAGAAGATGCAACCAGCATATTTGCTGGAAAGAT
AATTGCATGAAGTTCTTTGCAACTTCATCCGAATGTTATAACCATTTAGACGAGAATCAT
GGAGGTTATTGGTGA


>TTHERM_00538800(gene)
ATGTAGCAGCTTTAATAGGAACTCTCTGAACTCATAAACTAATAGGGTTAAGTTCAAGAT
ATACACAGTACATTAACAAGAAACTCTGCTTCTAATAGTATTATAAGAGAAGAAACATTA
CAAAACTATTTGATTTCTGAAAGTAAAGAAAGCCAAGAAAATTTAAAGCATATTATCCAA
AAAAGCAAAATAGATTATTTGTGCAAATTGTAATCAACTTTCACTAGCTCTGAATAAGAA
CAAGAGTTGGCTGAATATATCAAAGATTTCAAAAATAATTTTGGATATCTTGGAAGCGAC
TAAAATAGCCATGTTTGGTAAATTTTATAAAGTTTGAACGAACTTTAATCTGTAAATAGT
GGATTATCATTTATAACAGATAAAAACCCTATTTAGAATGGAGGACTCATTTTTTCTCTT
TTAAAGAGTGCTTTTAATCTTTATCATAAAATTAACTTAGTTAACATATTCGAATCATAA
GCTAGTGAAGACAAGAACTTAAAGCTATAACTAGACGAATAGATGATAGAGACAATTTGG
GACTCCGTTATCGTAAATGGATCCAATAATAAAAAAACTGTTTACTTTTTAAATTTAGAG
TTTTTGAATCCTTCTTAGATTATTTTTATAGCAAAGTTATAGAAACATTTAAATAATTTA
AAAAATGAAGCTTAGATTCCAAATATCGTGATTTACTCTGATGACATTTTAGCATCATAG
CTTAAAGAGTAGATAAAGCCTTAATTAGAAATAGTTTTGGAGTTCAAAAGAATGCCTCAA
AAAATTTAGTATGTATAGAATGCTATTTTATCACAAAAAAGTAAAATGGATTTAATAGAG
CAACTGATAATTGATGCTTTGAAAAAATACAAGCAAACTTTGTTGAGATTTGACGTGCTT
ATATTTGTTAAGAACATTGAAGAGAGCAAATACTTATAGCAACACTATTTAAATCTTATC
AAAGAAAAACTAAATATTATAGATTTGACAGATATTGAAGTGAATGAAGAAGAAAGTAAG
TTTTACTTAGAAGATTTCAAAAAGAATTGGGAAAAATAATTGGTCGAAAAAAAAATAAAA
GAAAAAGAATTAAAAATTTAACAAGAAAAAGAATAGTAGGCCAAGAAAATTGAGGAGGAG
TTAGCACTTGAAAGAGAAAGACAAAGGAAGATTGAAGAAGATAAAAATAAAATATTCGAT
GAAGAAAAAAAACTAATAAAAGAAAAAATAAATCAATAACAAGTATAATAAATACCAGAT
GTTCATCCTTTACAACAAATTAATTAAGATGAACTTAACATTCCTCCTTTCCCTGCTGTT
CCAGAAATATAGCAATAATAGTTAAACTTATAAGAAATATAGATAAATTAAAATTAAGAG
TAAGAGATCTAATTATAGAAAGTACAAAGAGAAGAAGAGATGGTAAAAGAAGAAGAAGAG
TAAAAAAGAAAAGAAGAAGAACTAATGGTAAAAGAAGAAGAAGAGAGAAAAAGAATTGAA
GAAGAAGAAGTGAGAAAAATAAGAGAAGATGAAGAAAACATTAAATTAAAATAATTATAA
GAAGAAGAAGAGAGAAAAAGAAGAGAAGAAGAAGAAATTAAATTAAAAGAAGATGAAGAG
ATAAAAAGAAAGCAAGATGAAGAAAATAAGTTGAAGCAGGAAGAAGAAGAAAGATAAAAA
GATATACAGCAATATAATGAAGATTTAAATAAATAGATTAATAAAAATAAGTAAAATCTC
TACAAAGCAAATGAATTTAATATTTTCATAGCTAAAAGCTATAAGCAATTGAAACATCAT
AACTTAGATAATGTAATCATTTAAATTGATACAGGTGAAGCATTCAAAGTATATTTCATG
GATACTATTTTTGATTAGATTCCTGTAGTAAGCTCTAAAATTACAAGAGAAGAAGCTATT
AAAAGAGAAAGACTCATTGGTAATACTAAATCATGCGAAATTCATAGATTGTATGAAAAA
AAAGAATTCCTTAGACTACAAAAGAGGGATTTTTTGAATTTAATAAATTTGGAATAGTAT
AAGGCCTTTTCAGAAATTTAAAATGAGAAATGCCCTTAAAAGTAAGCAATTAGGATTTTG
TTATAGATCATGATAAATCTTAGTGAAAACTGGTTTAGCTGCTCTTCAGAAGTAGGAGCT
CATATCTCAATTTTATGGAGTAGAATGGGTGATATCTTTTCTGTTCATAACTAGCTCTTG
GTTTCTTAGACTGATGATTTATATTTAGCTTGCTAAAATCTCAATCTGCAGAATATTTTA
GAAAAAAATCAAGTTAATTCAAATCAATATGATAAAATTGTTTATAAAATGCTCAATATT
CAAAAAGTTTTAAATATCAAAGAAGATCCAGTTAAAATCTTACAGAAATTAGAAGCAACC
AAATTTTCAGAACTTGTTCAGTAAGTTGCTATAGAAAAATATTGGAAAAATTTATGCGTT
TATTCAGGACATAGAAGACTTGGTTTCCGTCACTTTGAATCAGCTAAAATGTTGAACTAT
GCTGAAATAAGCAGCATGAACCTTATTTAAGAAAGACCTTTCCTTATTATTCCCCTTCAG
CTTCAAATTAATTCTAAAAATTAATATGAAATAAAGCAATGCTTAGCTATAGATCATCCT
TTTTTACTAGAAAATGCTCCTTCTTAATTTATTGAAAAGCATTAACTCAGACTGCTTAAA
AGACAAAGTTTGAATTTGCATGAGATCGAATATTTTGGTATTTCAGATGCGTTGTTCTAA
TACTTTGAAGATAACAATTAAATAATTAAAGATATGGAAAATAAATTCGATTGTTATTAT
GAGCCTAATCATCATATGGACACTATAACCATACATTCTGATGCAAGCTAAAAGGTAATT
CTTAATTTTATTATTTCAATTATGAAAATAAAAATTTTTTTTTTTTAATTTTCAACAGGA
AAAACTAGAAAAACACTTTAATAACTTGCTTTAAGAAGCATAAAAAATACTCTCAGAAGA
AGTTATGGAAATTTCACATGGAAACAACTGCATCCTAAAGATTTAAAAAGGAGGTACTAT
CAAAGAAGTTACTATTTTACAGAATGAACACATCTTTATTGTTGATAATCTACCCTTAAA
TGTGAAAGAGTAAGATGTTATAAATTTATTTGAAGAATATGGAGATATTGTTCAAGTCAA
ATTTTTCACTGATCCCACCCTCAAAAATGTTGAAGAAAAATCTATTTCTGCAGAAGTTTT
AGTGGCTGAAACAGAAGATTCCAAATTTTTTGTAGAAACATTTAATTAAATAGAATTTTA
AGATAGAGTCCTGCAGTTGCGTTTGAAAAACCACAGCTACTAAATACATCAAGATAATAA
TTCTACTAGATATCATAACATTTTTAGATGGCAAACTTGGAAATCAAAACAAACTGTAAT
TTTATTCATCTTTCTTTGAATTTTTATTGAAAAATATTTTTTTAAATTAAGGGAAGAATT
GAATTTCTTGATGAATCATCAGTTTAATCTTTTATGAAATTAGTTTAAAATAAACTAATT
GTTGATGGTAAGGAAATTAAAGCAGAATAGGATAAAAATTTTAATAAAACCGTCATATTG
AGTGGGCTATAAAAATGCACAGATGAAGAAACTTTAAAATCTTGTTTGATACCAGAACTT
TAAAAGAATATTGTGAGAATAAATGTAAATTGATTATTAATTAATATATTTGTTTATTTT
ACCATTTTATTTTTAATATAAAATAGGTAGATAGAATAGCTGATGTTGACAGAGGAATTA
GCAAAACTAGTTTAATATTCGCTCTTAATAAGATTTATAAAGAGTAACACTAAATAAGTT
GGGTAAGAAGAAAAGATCATGGTATTGTTGAAGCTAAAATATGCTTTTCTAAAAATTACT
TATATAAGATGAACACTTACTATGAAAGATTTAATAGTAAGCCAGATATTTTAGGATAAT
AAAAATTATATGTTTAAAGAAATTATATTGAAACCTTTAACTATGACTTGAAGATGATGA
ACGTAGTCTAAATGATATTAAAAGGTAATCAGGAATTAGTTTAAATGTAACAAAAGAATG
AAATAAAACTCAAGGAAAAAATTGTAAGACCAATTCCCTCTAAATAAGAATTCATTGTAA
TTTTGAAATGCAATGATGAAACCCACTTTAATAAGGCAAAAGGAATTATGTAAGCTCTGC
TTTAATCAAAACTGCTTGATTTGAGAAATGTATTAAAATAATTAAATTTAAAATAATTTT
TATAGATTGATTAATTAATTGAAATAGGTAAAATTAGATTTGGCCAGCTTATTCGATGAG
GAAGATTAAGTAGATTACTCTTAGTTGTTCACTGAAATAGGATAAAAGAAGCTCAAAGAA
ATAGAAAGCAAATACCCAGTATTTTTCAAAATAAATTTAATCAAAGAAGAAGTTAGAGTT
TTCTGTACTGATGCCATTTATGATTTGATAAATAAAGGTAAATTATTAATTAAGTTTAAA
ACAAAATTAAGGAATTTATAAAATAATTAAAGATGTTGAGTACTTCTTAAGATAGAGTGT
CAGAGTTAAAATTCCTATTAGTGGAAAAAATATTAGAAACATACTTGGAATAGATGGAAG
AGGTTTAGAAGAGTTTAAAAATAAAACTAACATTTGCAAAATTTAGCTAGACTACATATC
TAAAGACATTTATATGGAAGGTAATTCTAAGTAAGTTGACTAAGCTAAGAATGCTTTACT
TGCTTTATTGGAGGAAAAAAATAGCTAAGCATGCTTAAATAACATGCCTTATTCATATGA
AGATTGCTAAGTCTGCTCTGACACTATTGTCACAGGATACAGATTGCAAGTAATTCAAAG
ATATCAAATATTTTATTTTAACATTAATTGATATTTTTAAATAGAAATTGTCAAATAAAA
TATTTTAGAGCAAAATATTGATTTAATTTTTTAATTTATTAATTAGGGCTGTGGTCATAA
ATTTTGCCTAAGCTGTATTATGTTTGTAATAGATAATTCTTTAGGTGATGTGAATTCTCT
TCCAATTAAATGTCCTTTTTGCAGTTAAGCTATTATTATGAAAGATATAAAAACTCTTAT
GAGTGAGGATCAAATATAAAAAATGACAAGAATGTCTTTAAATCATTACATACAAAACAA
CTTTTAAGAATTCAGCTTTTGTGTGAATGAAAATTGTAAGTCTATTCATTCATCTAAACT
AACTAAATATACTTGTTATGAATGCAAAAAAACTTACTGTTCAAAGTGTGCAGCAGAATA
TCATTTTGGTATGACTTGTACAGTTTATTAGGAAACTGAAGCGAAAAACATAGAATTCTT
AATCAAAGAAGGTGCTCGTAAATGCCCTAATTGTGGAGTCTACATCATTCGTATAGATGG
ATGTTATAGGGTAGAATGTAGAAGATGCAACCAGCATATTTGCTGGAAAGATAATTGCAT
GAAGTTCTTTGCAACTTCATCCGAATGTTATAACCATTTAGACGAGAATCATGGAGGTTA
TTGGTGA


>TTHERM_00538800(protein)
MQQLQQELSELINQQGQVQDIHSTLTRNSASNSIIREETLQNYLISESKESQENLKHIIQ
KSKIDYLCKLQSTFTSSEQEQELAEYIKDFKNNFGYLGSDQNSHVWQILQSLNELQSVNS
GLSFITDKNPIQNGGLIFSLLKSAFNLYHKINLVNIFESQASEDKNLKLQLDEQMIETIW
DSVIVNGSNNKKTVYFLNLEFLNPSQIIFIAKLQKHLNNLKNEAQIPNIVIYSDDILASQ
LKEQIKPQLEIVLEFKRMPQKIQYVQNAILSQKSKMDLIEQLIIDALKKYKQTLLRFDVL
IFVKNIEESKYLQQHYLNLIKEKLNIIDLTDIEVNEEESKFYLEDFKKNWEKQLVEKKIK
EKELKIQQEKEQQAKKIEEELALERERQRKIEEDKNKIFDEEKKLIKEKINQQQVQQIPD
VHPLQQINQDELNIPPFPAVPEIQQQQLNLQEIQINQNQEQEIQLQKVQREEEMVKEEEE
QKRKEEELMVKEEEERKRIEEEEVRKIREDEENIKLKQLQEEEERKRREEEEIKLKEDEE
IKRKQDEENKLKQEEEERQKDIQQYNEDLNKQINKNKQNLYKANEFNIFIAKSYKQLKHH
NLDNVIIQIDTGEAFKVYFMDTIFDQIPVVSSKITREEAIKRERLIGNTKSCEIHRLYEK
KEFLRLQKRDFLNLINLEQYKAFSEIQNEKCPQKQAIRILLQIMINLSENWFSCSSEVGA
HISILWSRMGDIFSVHNQLLVSQTDDLYLACQNLNLQNILEKNQVNSNQYDKIVYKMLNI
QKVLNIKEDPVKILQKLEATKFSELVQQVAIEKYWKNLCVYSGHRRLGFRHFESAKMLNY
AEISSMNLIQERPFLIIPLQLQINSKNQYEIKQCLAIDHPFLLENAPSQFIEKHQLRLLK
RQSLNLHEIEYFGISDALFQYFEDNNQIIKDMENKFDCYYEPNHHMDTITIHSDASQKEK
LEKHFNNLLQEAQKILSEEVMEISHGNNCILKIQKGGTIKEVTILQNEHIFIVDNLPLNV
KEQDVINLFEEYGDIVQVKFFTDPTLKNVEEKSISAEVLVAETEDSKFFVETFNQIEFQD
RVLQLRLKNHSYQIHQDNNSTRYHNIFRWQTWKSKQTGRIEFLDESSVQSFMKLVQNKLI
VDGKEIKAEQDKNFNKTVILSGLQKCTDEETLKSCLIPELQKNIVRINVDRIADVDRGIS
KTSLIFALNKIYKEQHQISWVRRKDHGIVEAKICFSKNYLYKMNTYYERFNSKPDILGQQ
KLYVQRNYIETFNYDLKMMNVVQMILKGNQELVQMQQKNEIKLKEKIVRPIPSKQEFIVI
LKCNDETHFNKAKGIMQALLQSKLLDLRNVKLDLASLFDEEDQVDYSQLFTEIGQKKLKE
IESKYPVFFKINLIKEEVRVFCTDAIYDLINKDVEYFLRQSVRVKIPISGKNIRNILGID
GRGLEEFKNKTNICKIQLDYISKDIYMEGNSKQVDQAKNALLALLEEKNSQACLNNMPYS
YEDCQVCSDTIVTGYRLQGCGHKFCLSCIMFVIDNSLGDVNSLPIKCPFCSQAIIMKDIK
TLMSEDQIQKMTRMSLNHYIQNNFQEFSFCVNENCKSIHSSKLTKYTCYECKKTYCSKCA
AEYHFGMTCTVYQETEAKNIEFLIKEGARKCPNCGVYIIRIDGCYRVECRRCNQHICWKD
NCMKFFATSSECYNHLDENHGGYW