Identifiers and Description

Gene Model Identifier

TTHERM_00540100

Standard Name

RAB21A (RAB GTPase 21A)

Aliases

PreTt12168 | 70.m00164 | 3728.m00061

Description

RAB21A small GTPase family Rab protein; Rab V family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( PF00025 ) ADP-ribosylation factor family
  • ( PF00071 ) Ras family
  • ( PF00880 ) Nebulin repeat
  • ( PF01926 ) GTPase of unknown function
  • ( PF08477 ) Miro-like protein
  • ( TIGR00157 ) ribosome small subunit-dependent GTPase A
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR02528 ) ethanolamine utilization protein, EutP

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18212.1 4.99780462713828e-94
Description: Ras family protein (588 aa)
Oxytricha Contig22470.0.g95 1.9997255150861791e-53
Description: Ras family
DictyBase DDB_G0286553 5.001531130907917e-44
Description: rab21 on chromosome: 4 position 4804109 to 4805424
WormBase WBGene00004268 7.00174216458014e-43
Description: locus:rab-5 status:Partially_confirmed UniProt:P91857 protein_id:CAB04205.1
SGD YOR089C 9.99648502569394e-38
Description: VPS21 Rab family GTPase required for endocytic transport and for sorting of vacuolar hydrolases; localized in endocytic intermediates; detected in mitochondria; geranylgeranylation required for membrane association; mammalian Rab5 homolog
Stentor Coeruleus SteCoe_10189 1.2995814250075031e-24
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00540100(coding)
ATGAGCAAAGGTACAATGAATAAAATAGTCATTATTGGTGAAGGTAGAGTTGGAAAGACT
TCACTTACATTGAGATATTGCAAAGGAGAATATAGCGATACATAAGAATCTACAATTAAT
GTTTCTTATTTAGAAAAAACAGTCCAAGTAAATGAGACAGATAAAGTTAACATTGCTATT
TGGGATACTGCAGGACAAGAAAAATTCAAATCTATAACTCCTATGTATTACTAGTAAGCT
GTCTGCGCTATTATTGTATATGATATTACTTATAAAGAATCTTTTGATAAGGTTAAATCG
TGGGTTACTGAGCTAACTTAAATTTTAGATACAAATAAGATAGTAATATGTATAGCAGGA
AACAAGTGCGATCTAGAAAATAATAGATAAATTGATAAATAATTTGCAGAAGATTATGCT
AAATCTGTGGGTGCTCGTCATTTCCTTACATCTGCTAAAAACAACAGAGGTATTGATGAA
CTTTTCTAATATGTTGGCTAAGAAATTCTAAAAAGAAATACTAACAAAGGAAAGAAAAAT
AGTAAAATGATTATAAATAATCAATCAATTCTTGAAGGTGATAAAAAGAAAGAAGAAAAA
AAGAAGAAGGACTCTTGCTGTTGA


>TTHERM_00540100(gene)
ATGAGCAAAGGTACAATGAATAAAATAGTCATTATTGGTGAAGGTAATTATTGCTTTTTA
CTTTTAGAAGATATTCATTAAAATAGTTAAAAACTTTTTTGATATTTCTTGTAAATATTG
AGAAAAAAATATGGATGCTTTTAATCAATCAAACAAAATAATATCTAAAATTGAGAATAT
TTTTATTGGAAAATGTTTAGGTAGAGTTGGAAAGACTTCACTTACATTGAGATATTGCAA
AGGAGAATATAGCGATACATAAGAATCTACAATTAATGTTTCTTATTTAGAAAAAACAGT
CCAAGTAAATGAGACAGATAAAGTTAACATTGCTATTTGGGTAAAAATTATTATTAATAA
TAAAATAGTTTCTGATAAATATTATCTTTAAAATTGCATTATTTTATTTAAAATTTAGTA
TTTGCTAACATAATTTTTTATATAAAAGGATACTGCAGGACAAGAAAAATTCAAATCTAT
AACTCCTATGTATTACTAGTAAGCTGTCTGCGCTATTATTGTATATGATATTACTTATAA
AGAATCTTTTGATAAGGTAAATACAATTAATTATCTTATTTTGAATATATTATACTAATT
TCTCCTATAAAAAAATGATATTTTTCATTCAATTTAGTTTATTTATTTGATCAATTAATG
AAATATAATAGGTTAAATCGTGGGTTACTGAGCTAACTTAAATTTTAGATACAAATAAGA
TAGTAATATGTATAGCAGGAAACAAGTGCGATCTAGAAAATAATAGATAAATTGATAAAT
AATTTGCAGAAGATTATGCTAAATCTGTGGGTGCTCGTCATTTCCTTACATCTGCTAAAA
ACAACAGAGGTATTGATGAACTTTTCTAATATGTTGGCTAAGGTAATAAATAAATAAATA
AATAAATTAATATTATTAAGCTTAATAGTTTGTTGTTTTATAATTTTAATAACATTTTAT
AAAAAAGAAATTCTAAAAAGAAATACTAACAAAGGAAAGAAAAATAGTAAAATGATTATA
AATAATCAATCAATTCTTGAAGGTGATAAAAAGAAAGAAGAAAAAAAGAAGAAGGACTCT
TGCTGTTGA


>TTHERM_00540100(protein)
MSKGTMNKIVIIGEGRVGKTSLTLRYCKGEYSDTQESTINVSYLEKTVQVNETDKVNIAI
WDTAGQEKFKSITPMYYQQAVCAIIVYDITYKESFDKVKSWVTELTQILDTNKIVICIAG
NKCDLENNRQIDKQFAEDYAKSVGARHFLTSAKNNRGIDELFQYVGQEILKRNTNKGKKN
SKMIINNQSILEGDKKKEEKKKKDSCC