Identifiers and Description

Gene Model Identifier

TTHERM_00541547

Standard Name

LSF12 (Fusion of leishmanolysin-like peptidase and subtilisin-like proprotein convertase)

Aliases

3729.m00772

Description

LSF12 leishmanolysin family protein; Fusion of leishmanolysin-like peptidase and subtilisin-like proprotein convertase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00008 ) EGF-like domain
  • ( PF00757 ) Furin-like cysteine rich region
  • ( PF01033 ) Somatomedin B domain
  • ( PF01457 ) Leishmanolysin
  • ( PF01754 ) A20-like zinc finger
  • ( PF01826 ) Trypsin Inhibitor like cysteine rich
  • ( PF02363 ) Cysteine rich repeat
  • ( PF03128 ) CXCXC repeat
  • ( PF03302 ) Giardia variant-specific surface protein
  • ( PF07974 ) EGF-like domain
  • ( PF09146 ) BmKK2 toxic
  • ( PF09257 ) BCMA, TALL-1 binding
  • ( TIGR01918 ) selenoprotein B, glycine/betaine/sarcosine/D-proline reductase family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17014.1 9.997093137033517e-262
Description: leishmanolysin family protein (1343 aa)
Stentor Coeruleus SteCoe_19005 1.8048513878454153e-35
Description: None
Oxytricha Contig169.0.g12 5.999781043483669e-32
Description: Tubulin-tyrosine ligase family
DictyBase DDB_G0293364 5.00094715178354e-25
Description: sigB on chromosome: 6 position 2822106 to 2824254
WormBase WBGene00012796 7.997402223525235e-19
Description: Leishmanolysin-like peptidase status:Partially_confirmed UniProt:O62446 protein_id:CAB16471.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00541547(coding)
ATGAATAGATTTACTATTTTATTGCTTTTAACTGCTTTGTTAGTAAGTGCTCATAATACT
AATAAATAAGCTGTCAATACCTGTCTATAAGATGAGATAGATATGAGCGAAATGGTCCCA
AAGGATTACTTAGAAACCTTTGATGAAAATTATGGAAACAGAAAACTTTAGAATTCCGAA
CCCTAGCCTATTAGAATCACTCTTGATTTCAAAGAGCTCGATAACCCTTAAAATGGTGAA
GGAATTACTCCTAAAATAAAGGAATACTTAAAGAAAATTATGTTTGCTGCTCAAACATAC
TTGAATAAGCTCATTAAAGTAATTCCTAGATAAAAACCTATTAAGTATAACTGGAGTGGA
GATACATGCTATGATGTTAAGGTTTCAGAGGAAATAAAAACAGTGGGTATTGATAACTCA
GATATACATATTTTTGTCACATATACTAATCAATCAAACAGAACCTACTTAGCCAATGCA
ATATGGTGCCAGTTAGACCCTAACCCTAATGTTGGAAGAGTTAAATTTAATATTGGTACT
ATGAGTATTGATGAATCCTCAACTTAGTCTTTTTAAAATAATTTCTCAACTGCTTTACAT
GAAATTATCCACATTTTAGGTTTTTCAGGTGCCAGTGTTTCTTATTGGATTGATCCTGAA
ACAAATAAACCTTACGGAGGAAAAAATGAATATAAGGTTATGAAAAGAGAAAGAAGATGG
GAGGTGGATAATGTAGTTAAAGTGCTCTCTAAAAATATTTTGAAAGTCTCTAGAGATCAC
TACAATTGCCCTTCAATAGATGGTATGTATCTCGAAAATTAAGGTGGTGGTGGCTCTATG
GGTTCTCATTGGGAAAGGGATTTACTTGGTAATGAATTTATGACAGGTAGCATCGTTTAT
GGTGTCTACACTATATCTAAATTTACAGCTGCTCTTCTCTTAGATACTGGTTATTATGCT
GAAATTAATTCTAATCTTCTTATGCCTATTTACTGGGGTAAAAATAAGGGATGTGATTTC
TTCAATAAAACTTGTAATACTGGAAAATATTTCCCTGAGTTCCCAGATGACAGTGTAAAA
GAATCTTGTGACTTCTTTTCTTTAGGTATTGGTGGTCTACATAATTATGATTACTTCTCT
TAATGTAAAACTATCTTTTCATATTCAAATGCTTATTGCGAATCTGATAAATTTAAACCT
GATGAAAGATTGAGATAAAATACTGGTACCGGATCAAGATGCTTTAGATCTAATGCTAAT
GTCAAAGGAAATGAAGTTTTAGATATGAATGGTAGATGCTTTAAGGCTTAGTGTGCAGAT
GATCTATCTTCCATTAAAGTTAATGTATGGGGTGATGAATACGTTACTTGCAAATACCCC
AATTAAGTCATTAACTTAGCTGATCAAACTAAAACAACTCAAGGTACTATGAAATGTCCT
CATGATTTTGATTTGTTTTGCAATTTCCCTAAGTCATGCCCCAATAATTGCTCTAACAAT
GGTGTCTGTAATAATGGTTATTGTGTATGCCTTAAAGGATACGGTGATGCCGATTGCTCT
AAAAGATGTGGTGAAGGTTAAGTTTGGGATGGATCTGGTTGTGTTTATAACTGCCCTTCT
GGATAGTTCAAAAACTTTGATAACACTTGCAAACCCACTTGTCCATACAAATAATATGGA
GATCAAGCCACAGGCAGCTGTGTTCTCTGTTCTGTTAACTGTTCAGCATGCTTTGGCCCT
TCATAAAACCAATGTTTATCTTGTAATGACGGATATTCGCTTTAAGGAAATTAATGTGTT
GATACTACCTGCCACTCTAGCTGTCAATCATGCTCTGGTCCAAATTCAAATCAATGTACT
TCTTGCCCTGCTGGCTAGTATTTGGACTCTAGAAAAACTTGCCAACCATGCTAATATCCT
TGTGAAAATTGTTTCAACTCAGCTACAGAGTGTACAACTTGTGGATAAGGATATGAAATG
GATAAATTTATTGGTAAATGTGTATCTATGAATACATGCGATACCTCTTGTCTTGAGTGC
TCAGCTTTTAGAGATCCCACTAAATGCACTACTTGTAGAGAGGGCTAATTCCTAAACTAA
GAAGGTAGATGTTAAAAATGTGATGAGTCATGTGCTACTTGCTCTGAACGAGACTATAAA
TGCATAAAATGTGCTGACGGATGGGAATATGATGAATATAATAAAAGATGTCGTATGGAT
TGCCATGAAAGTTGTGATACATGTACAACTCTTTAAGATCCTACAGCTTGTAAGAGATGT
GCTTTTAATTACGTCATGTAGAATAATCTATGTGTACCTTGTGATAAAAGTTGTTATGGA
TGCACATATAATCCTAAAAAATGTACTAATTGTTAAATAGGGTACAAACTAGATTCAAAT
TATCAAACTTGTTTCCCTATTTGTAATTCTGACGAATTCCAAGATAGAAATGGAAACTGT
TAAAAATGTGCATCTCCTTGCGCCACATGTGAATATTATAATAACTATTGCAATAGTTGT
ATAGCTGGTTATACTTATTTAGCCTTACATAAATCTTGTTAGCCTGCTAGAAATAAATGT
CATGAAAATTGTGAATAATGTAATAGATATGATGACCCTAATGCATGTACATCTTGTACA
GATGGAATGTTTTTATAATCTGGGAGATGTCAAAACTGTAGTAATAAATGCTAAAGTTGT
GATAGAGATGCTAATATTTGTACATCTTGCAGAAAGGATGAGTTCTTGTAAAATAGAGAA
TGTATGAAGTGTCATAGTTCTTGTTTGACTTGCAATGGAATTTCAACAAACTGTACTTCT
TGTCAAAATGGTTTCTCAAAAGACCTAAAGACAGGTCTTTGTGTAGACAGTACACCTGTT
TGCAAAAGTGATGAATACATGAATAGAAATTATAAATGCTAGAAATGTATTTCACCTTGT
GCTTCTTGTTTCTACTATCATAACAGATGTTCTAGTTGTATTTCTGGTTACAAATTGAAC
ACTCAAACCTATTAATGCGAATATGATTATCCTATATGCTAAGATGGGTAGTTCTTAGAC
TAGGATAATAAATGTAAGCCTTGTGATCCTTCTTGTGCTACTTGTGATTAAACAAGTAAA
AGATGTACAAGTTGTAAATCTGGTTTTGTTCTATCAAGATAGACTTGCTAAGCAGCTAAT
TGCTAAGATGGAACCTTCATGAACTAATAAGGAAGATGCTAAAGATGTAGTGAGTCTTGC
TCTAAGTGTGTAAACTATTCAGATAACTGTACTGAATGTGCTAGTGGATATACTTTAGAT
ACAGGAACTTAAAGATGCATTAAAAACTAAAATAAATGTCATCCCTCATGTTTAGAATGC
AGCTAACTCAATAATGCTTCTGCCTGCAAATCCTGTAATGATGGCCAATATTTAAATAGA
GATTAATGCCTTTAATGTAATAGCTCTTGTTTAACATGTAATAGGTATTCAGATTTTTGT
ACTTCGTGTTAGCAAGGTTATAATCTAGATAGCACCTACGGTAAATGTACTCCTGATTGC
AAAAAAAGTGAATACTTAGACTACTAAGATAACAAATGCAAGCCTTGCACATCTAATTGT
GGAAGTTGCGAATACTACCCAGATAGATGTCTTAGCTGTATTTCAGGTTATAAGTATAAT
AAAGAAGGAAATAGCTGCGAAATAGTTTGCTAGCCTGGATAATATGACGATGGATATTAG
ACTTGCAAACCTTGCTCATCTCCATGCGCAACTTGCGAATATTATGATAATAGATGTTTG
AGTTGTGTCTCTGGATATACTTACAATAACTACTATTGCAAATACATGTCAAAGTAAAGT
GCAAGAGGCTGTCACAAATCTTGTCATACCTGCACAAAAGCAATGGATCCTCGTTCATGT
GATTCCTGTAGAGAAGGATATGAATTAATAAATGGGGCTTGCCTAAGAAAGACAGGCAAC
TATTCTGGCCCTAAAAATTGA


>TTHERM_00541547(gene)
ATGAATAGATTTACTATTTTATTGCTTTTAACTGCTTTGTTAGTAAGTGCTCATAATACT
AATAAATAAGCTGTCAATACCTGTCTATAAGATGAGATAGATATGAGCGAAATGGTCCCA
AAGGATTACTTAGAAACCTTTGATGAAAATTATGGAAACAGAAAACTTTAGAATTCCGAA
CCCTAGCCTATTAGAATCACTCTTGATTTCAAAGAGCTCGATAACCCTTAAAATGGTGAA
GGAATTACTCCTAAAATAAAGGAATACTTAAAGAAAATTATGTTTGCTGCTCAAACATAC
TTGAATAAGCTCATTAAAGTAATTCCTAGATAAAAACCTATTAAGTATAACTGGAGTGGA
GATACATGCTATGATGTTAAGGTTTCAGAGGAAATAAAAACAGTGGGTATTGATAACTCA
GATATACATATTTTTGTCACATATACTAATCAATCAAACAGAACCTACTTAGCCAATGCA
AGTAAAAATTATATTTTCATTATACTTAATATTAAAATGTTATATTATTAAATTAGTATG
GTGCCAGTTAGACCCTAACCCTAATGTTGGAAGAGTTAAATTTAATATTGGTACTATGAG
TATTGATGAATCCTCAACTTAGTCTTTTTAAAATAATTTCTCAACTGCTTTACATGAAAT
TATCCACATTTTAGGTTTTTCAGGTGCCAGTGTTTCTTATTGGATTGATCCTGAAACAAA
TAAACCTTACGGAGGAAAAAATGAATATAAGGTTATGAAAAGAGAAAGAAGATGGGAGGT
GGATAATGTAGTTAAAGTGCTCTCTAAAAATATTTTGAAAGTCTCTAGAGATCACTACAA
TTGCCCTTCAATAGATGGTATGTATCTCGAAAATTAAGGTGGTGGTGGCTCTATGGGTTC
TCATTGGGAAAGGGATTTACTTGGTAATGAATTTATGACAGGTAGCATCGTTTATGGTGT
CTACACTATATCTAAATTTACAGCTGCTCTTCTCTTAGATACTGGTTATTATGCTGAAAT
TAATTCTAATCTTCTTATGCCTATTTACTGGGGTAAAAATAAGGGATGTGATTTCTTCAA
TAAAACTTGTAATACTGGAAAATATTTCCCTGAGTTCCCAGATGACAGTGTAAAAGAATC
TTGTGACTTCTTTTCTTTAGGTATTGGTGGTCTACATAATTATGATTACTTCTCTTAATG
TAAAACTATCTTTTCATATTCAAATGCTTATTGCGAATCTGATAAATTTAAACCTGATGA
AAGATTGAGATAAAATACTGGTACCGGATCAAGATGCTTTAGATCTAATGCTAATGTCAA
AGGAAATGAAGTTTTAGATATGAATGGTAGATGCTTTAAGGCTTAGTGTGCAGATGATCT
ATCTTCCATTAAAGTTAATGTATGGGGTGATGAATACGTTACTTGCAAATACCCCAATTA
AGTCATTAACTTAGCTGATCAAACTAAAACAACTCAAGGTACTATGAAATGTCCTCATGA
TTTTGATTTGTTTTGCAATTTCCCTAAGTCATGCCCCAATAATTGCTCTAACAATGGTGT
CTGTAATAATGGTTATTGTGTATGCCTTAAAGGATACGGTGATGCCGATTGCTCTAAAAG
ATGTGGTGAAGGTTAAGTTTGGGATGGATCTGGTTGTGTTTATAACTGCCCTTCTGGATA
GTTCAAAAACTTTGATAACACTTGCAAACCCACTTGTCCATACAAATAATATGGAGATCA
AGCCACAGGCAGCTGTGTTCTCTGTTCTGTTAACTGTTCAGCATGCTTTGGCCCTTCATA
AAACCAATGTTTATCTTGTAATGACGGATATTCGCTTTAAGGAAATTAATGTGTTGATAC
TACCTGCCACTCTAGCTGTCAATCATGCTCTGGTCCAAATTCAAATCAATGTACTTCTTG
CCCTGCTGGCTAGTATTTGGACTCTAGAAAAACTTGCCAACCATGCTAATATCCTTGTGA
AAATTGTTTCAACTCAGCTACAGAGTGTACAACTTGTGGATAAGGATATGAAATGGATAA
ATTTATTGGTAAATGTGTATCTATGAATACATGCGATACCTCTTGTCTTGAGTGCTCAGC
TTTTAGAGATCCCACTAAATGCACTACTTGTAGAGAGGGCTAATTCCTAAACTAAGAAGG
TAGATGTTAAAAATGTGATGAGTCATGTGCTACTTGCTCTGAACGAGACTATAAATGCAT
AAAATGTGCTGACGGATGGGAATATGATGAATATAATAAAAGATGTCGTATGGATTGCCA
TGAAAGTTGTGATACATGTACAACTCTTTAAGATCCTACAGCTTGTAAGAGATGTGCTTT
TAATTACGTCATGTAGAATAATCTATGTGTACCTTGTGATAAAAGTTGTTATGGATGCAC
ATATAATCCTAAAAAATGTACTAATTGTTAAATAGGGTACAAACTAGATTCAAATTATCA
AACTTGTTTCCCTATTTGTAATTCTGACGAATTCCAAGATAGAAATGGAAACTGTTAAAA
ATGTGCATCTCCTTGCGCCACATGTGAATATTATAATAACTATTGCAATAGTTGTATAGC
TGGTTATACTTATTTAGCCTTACATAAATCTTGTTAGCCTGCTAGAAATAAATGTCATGA
AAATTGTGAATAATGTAATAGATATGATGACCCTAATGCATGTACATCTTGTACAGATGG
AATGTTTTTATAATCTGGGAGATGTCAAAACTGTAGTAATAAATGCTAAAGTTGTGATAG
AGATGCTAATATTTGTACATCTTGCAGAAAGGATGAGTTCTTGTAAAATAGAGAATGTAT
GAAGTGTCATAGTTCTTGTTTGACTTGCAATGGAATTTCAACAAACTGTACTTCTTGTCA
AAATGGTTTCTCAAAAGACCTAAAGACAGGTCTTTGTGTAGACAGTACACCTGTTTGCAA
AAGTGATGAATACATGAATAGAAATTATAAATGCTAGAAATGTATTTCACCTTGTGCTTC
TTGTTTCTACTATCATAACAGATGTTCTAGTTGTATTTCTGGTTACAAATTGAACACTCA
AACCTATTAATGCGAATATGATTATCCTATATGCTAAGATGGGTAGTTCTTAGACTAGGA
TAATAAATGTAAGCCTTGTGATCCTTCTTGTGCTACTTGTGATTAAACAAGTAAAAGATG
TACAAGTTGTAAATCTGGTTTTGTTCTATCAAGATAGACTTGCTAAGCAGCTAATTGCTA
AGATGGAACCTTCATGAACTAATAAGGAAGATGCTAAAGATGTAGTGAGTCTTGCTCTAA
GTGTGTAAACTATTCAGATAACTGTACTGAATGTGCTAGTGGATATACTTTAGATACAGG
AACTTAAAGATGCATTAAAAACTAAAATAAATGTCATCCCTCATGTTTAGAATGCAGCTA
ACTCAATAATGCTTCTGCCTGCAAATCCTGTAATGATGGCCAATATTTAAATAGAGATTA
ATGCCTTTAATGTAATAGCTCTTGTTTAACATGTAATAGGTATTCAGATTTTTGTACTTC
GTGTTAGCAAGGTTATAATCTAGATAGCACCTACGGTAAATGTACTCCTGATTGCAAAAA
AAGTGAATACTTAGACTACTAAGATAACAAATGCAAGCCTTGCACATCTAATTGTGGAAG
TTGCGAATACTACCCAGATAGATGTCTTAGCTGTATTTCAGGTTATAAGTATAATAAAGA
AGGAAATAGCTGCGAAATAGTTTGCTAGCCTGGATAATATGACGATGGATATTAGACTTG
CAAACCTTGCTCATCTCCATGCGCAACTTGCGAATATTATGATAATAGATGTTTGAGTTG
TGTCTCTGGATATACTTACAATAACTACTATTGCAAATACATGTCAAAGTAAAGTGCAAG
AGGCTGTCACAAATCTTGTCATACCTGCACAAAAGCAATGGATCCTCGTTCATGTGATTC
CTGTAGAGAAGGATATGAATTAATAAATGGGGCTTGCCTAAGAAAGACAGGCAACTATTC
TGGCCCTAAAAATTGA


>TTHERM_00541547(protein)
MNRFTILLLLTALLVSAHNTNKQAVNTCLQDEIDMSEMVPKDYLETFDENYGNRKLQNSE
PQPIRITLDFKELDNPQNGEGITPKIKEYLKKIMFAAQTYLNKLIKVIPRQKPIKYNWSG
DTCYDVKVSEEIKTVGIDNSDIHIFVTYTNQSNRTYLANAIWCQLDPNPNVGRVKFNIGT
MSIDESSTQSFQNNFSTALHEIIHILGFSGASVSYWIDPETNKPYGGKNEYKVMKRERRW
EVDNVVKVLSKNILKVSRDHYNCPSIDGMYLENQGGGGSMGSHWERDLLGNEFMTGSIVY
GVYTISKFTAALLLDTGYYAEINSNLLMPIYWGKNKGCDFFNKTCNTGKYFPEFPDDSVK
ESCDFFSLGIGGLHNYDYFSQCKTIFSYSNAYCESDKFKPDERLRQNTGTGSRCFRSNAN
VKGNEVLDMNGRCFKAQCADDLSSIKVNVWGDEYVTCKYPNQVINLADQTKTTQGTMKCP
HDFDLFCNFPKSCPNNCSNNGVCNNGYCVCLKGYGDADCSKRCGEGQVWDGSGCVYNCPS
GQFKNFDNTCKPTCPYKQYGDQATGSCVLCSVNCSACFGPSQNQCLSCNDGYSLQGNQCV
DTTCHSSCQSCSGPNSNQCTSCPAGQYLDSRKTCQPCQYPCENCFNSATECTTCGQGYEM
DKFIGKCVSMNTCDTSCLECSAFRDPTKCTTCREGQFLNQEGRCQKCDESCATCSERDYK
CIKCADGWEYDEYNKRCRMDCHESCDTCTTLQDPTACKRCAFNYVMQNNLCVPCDKSCYG
CTYNPKKCTNCQIGYKLDSNYQTCFPICNSDEFQDRNGNCQKCASPCATCEYYNNYCNSC
IAGYTYLALHKSCQPARNKCHENCEQCNRYDDPNACTSCTDGMFLQSGRCQNCSNKCQSC
DRDANICTSCRKDEFLQNRECMKCHSSCLTCNGISTNCTSCQNGFSKDLKTGLCVDSTPV
CKSDEYMNRNYKCQKCISPCASCFYYHNRCSSCISGYKLNTQTYQCEYDYPICQDGQFLD
QDNKCKPCDPSCATCDQTSKRCTSCKSGFVLSRQTCQAANCQDGTFMNQQGRCQRCSESC
SKCVNYSDNCTECASGYTLDTGTQRCIKNQNKCHPSCLECSQLNNASACKSCNDGQYLNR
DQCLQCNSSCLTCNRYSDFCTSCQQGYNLDSTYGKCTPDCKKSEYLDYQDNKCKPCTSNC
GSCEYYPDRCLSCISGYKYNKEGNSCEIVCQPGQYDDGYQTCKPCSSPCATCEYYDNRCL
SCVSGYTYNNYYCKYMSKQSARGCHKSCHTCTKAMDPRSCDSCREGYELINGACLRKTGN
YSGPKN