Identifiers and Description

Gene Model Identifier

TTHERM_00543590

Standard Name

EPK1 (EpipPlasm associated Kinase 1)

Aliases

PreTt15007 | 71.m00134 | 3729.m00014

Description

EPK1 protein kinase; Kinase family protein; localizes to epiplasm

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17017.1 9.997093137033517e-262
Description: hypothetical protein (718 aa)
WormBase WBGene00012162 0.0000000000010000211161514907
Description: locus:sek-6 status:Partially_confirmed UniProt:O01706 protein_id:CAB08354.1
Oxytricha Contig15625.0.0.g55 0.00000000019994075865167896
Description: Protein kinase domain
SGD YDL159W 0.0000000020002373268528243
Description: STE7 Signal transducing MAP kinase kinase involved in pheromone response, where it phosphorylates Fus3p, and in the pseudohyphal/invasive growth pathway, through phosphorylation of Kss1p; phosphorylated by Ste11p, degraded by ubiquitin pathway
DictyBase DDB_G0270814 0.0000029996948234116693
Description: nek2 on chromosome: 1 position 4847143 to 4848761

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00543590(coding)
ATGGGAGAGACAAATTCAAAACCACAACCTAATGTAGATTTCTTAAGAGTATTCTAAAGA
GAATACAAGGAAATCGGGGAAGAAATCGATACTCGTCTTGGTAATGTCAAGGTATATTAG
GGTCCTCAAAGTAATTTGGTAGCTGTCAAGAATAACTTCTTAATGAGCAAAGAGCTTATG
GAAGAATTTGTAGAAAACAATCTGCCAAAAGCACTAAATACTTAAAATCGTTACTTAATG
AAGGTACTTTCCTACAAGACTCACTCTGAAGATAGCATGTGTGGTTCTGTCAACGGTATC
ACTACCTACCATGAATATTACCAAAACACAGTTCAAGATGAGCTCGTCAGACGTTAACAA
GTCAGTCTCTACTACATAGAACAAGAGTTATGGGCTATTCTCTACTCTATTGTAAGTGCT
GCTTATTATCTTGAAAAGAACAATCTCATTCCTCTTACTGACGTCCGTCCTTCTACTGTT
TATTTCACTTTAAAGGGAGAAGTTAAGCTTATGCCTTTTGGTATTTTCCCTGAAGATATC
AGTGGTTATGCTAAATGCTTTAGCCAAAGCGAATAGAGCTACCTTTCTCCTGAATAGATT
GAAGAAATGAGAAAAAGAAAGCAAGTTCCTGATGTCAACCAAGTCAAGAGTGATGTCTAC
TCTATTGGTATGACCATGCTTGCTTGCGCTACTTTACAAACTAGCCCAAGCTGGTACAAT
TACGATGAATGCTCAATCAACTACAACTACGTTAACTACCTCCTTGACTTCTCTAAAAAC
TAATACTCAGACTTCTTCTGCAAGGTTGTTAAAATTATGCTCAGTGAAAACGCTGAAGAT
AGACCTACTCCTTCAATTATCTACAAAATTTTGCAACCCTATGAGAAGGACATCTTAGCA
TTGAAACCCTTCAATCCTGAAAAGGAAATCATCAAGAAATCTCTTGAATAAGAAAGCTCC
TAACTCAAGGTTTCAGAATAATAAGGAGAGAAACTTTTTGCAGACGACAACATTTTACAA
AATGGCCAATAAAGCAGTGTTCAATAATCTAACTCTCCTATTTTCGTTAAGGTTCCTTAT
CTTGGCGAAGATGGTAAAATCTACTACTAATAAGCTCCCTAACAATAATTTGAATATTTG
ATCTAATAATCTGATGGTTAACCCATTCCTCAATTAGAAAATCAATTCTTCTACCATGAT
CAATTCAACAACTAAACTAATCCTGTATATGTTAACGAGCCTACAAACCAAAGTGGAGTT
TACGTATCTTACTCCTAACCACCTGTTCAATAAGTTGAATACATTCAACCCAATACTGCT
ATCAGTGGAGTTTAATACGTCTAATCTGCTGCTCAACCTTAGGTTATCTTGAATGGAGCT
AGACAACACTACTCTTAAGTTTTAACTCAACCTGTATACTAGTAAGTTTCTTATGAAAAT
CAATCTGCTTCAATTCCCACAGCTTCATAACTCATCATGAATCCTGCTCCTTAATCTGGT
GTTTAATACGTATAAACTACCACTAGTCCTTACCACCCTGGCTAATCTCAAATTATTGCT
CAATATTCTTACAATATTGAAGAAAAGCCCTTTACTTCTATTCCTTTACAACAAAACTAA
GTAGCCTACCCTCAAACTGGAGCTGAAATTACTAATAGCCATGTCTAAATAAATCCTATG
GTTAACACTATTTAATACACTCCTATTAATAATTTAACTTCTAACTCTACTATTCAATAA
TAGTAGCCTGCTGAAGAAACTGTTAAGAAAGCTATGCGCCAAACTCAAAGCGACTAACAA
ATGGTTAACTAAGATATTTATGCTAACTAGATCTAATACAATAATGCTCCCACTTATGGT
ACTACATTTGCAGCTCATGAACCTGAAAGTCCTATTGGTATGGTTAGTGCAAACTAATAT
CCTTCTGAAATCAATAACACCGCTGCATTCTAAATTGGCTCCACAACTTATGGTGGTATT
AGATCAGATGCCGTCTAATCTAGTAATGCTAACTACCTTCCCAGTACCGTAGTTAACCAA
TAATACACATCCACTACTACTGGAAACAATGATATGATGAATGAAATAAACCGTCGTATC
AATTAAGTCCTATAAAGCAGTTAAAATGTCATAAGTAACTCTTAAGTCGGAAAATATTAA
TAATGA


>TTHERM_00543590(gene)
ATGGGAGAGACAAATTCAAAACCACAACCTAATGTAGATTTCTTAAGAGTATTCTAAAGA
GAATACAAGGAAATCGGGGAAGAAATCGATACTCGTCTTGGTAATGTCAAGGTATATTAG
GGTCCTCAAAGTAATTTGGTAGCTGTCAAGAATAACTTCTTAATGAGCAAAGAGCTTATG
GAAGAATTTGTAGAAAACAATCTGCCAAAAGCACTAAATACTTAAAATCGTTACTTAATG
AAGGTACTTTCCTACAAGACTCACTCTGAAGATAGCATGTGTGGTTCTGTCAACGGTATC
ACTACCTACCATGAATATTACCAAAACACAGTTCAAGATGAGCTCGTCAGACGTTAACAA
GTCAGTCTCTACTACATAGAACAAGAGTTATGGGCTATTCTCTACTCTATTGTAAGTGCT
GCTTATTATCTTGAAAAGAACAATCTCATTCCTCTTACTGACGTCCGTCCTTCTACTGTT
TATTTCACTTTAAAGGGAGAAGTTAAGCTTATGCCTTTTGGGTAATTGATACATTTTATA
CTAATTCCTTAACAGTTTTTTATTTCTATCTCTAAAAATCAAACGTATTAGACATATGAG
CATTTCATTATTCTATGATTAGCTATATCCTATGTCTATGAAATAAAGATTATTCTGTTT
TTTCAATTTGAGTTGATAAGATTTCTTTGAAATACTTAAAAGGAATCTAATCTTGAGCTC
ATCAAATAAAAATGCCTCCCAAAATAATTTAAGGAGCAATCAAATGGTAGTTTATAGAGA
TAGGGCTTTCAAGAACATTATTTCAGTTTATAAAATAGCTCTTTATCTATCCATCATTTT
TACACATTTTTAGAGATTGAAATAAAATTATAAAATAAAAATAAATTAACTCAGCAAATG
TCTAAGCATTTTATTTATAAAATAGTATTTTCCCTGAAGATATCAGTGGTTATGCTAAAT
GCTTTAGCCAAAGCGAATAGAGCTACCTTTCTCCTGAATAGATTGAAGAAATGAGAAAAA
GAAAGCAAGTTCCTGATGTCAACCAAGTCAAGAGTGATGTCTACTCTATTGGTAATTTAT
TTAATAGGCATTAACTTAATCTACTTTTCACTTCAAAATGATAACATTTTAATTCATAGC
AAATAATGAATACAATAGCTTAAAAAAATAAAGAAAGAAAGAAAGAAAGAAATAAATTAA
TGAAGAAAGTTAGTAGCGGTTTATCAAAATAACTAATTTCAAAATTTAGGGTATTAAAGA
TACAATAAATTTTAGATGAAATAAATTTTTAATTTGCTTTTTGACTGAATCATAAATCAT
AAATTTATAAATTAATGAATGAATGAATGCGTGAGTGAGTGAGTGATTGGATGAATAAAT
GAACGCAAAAGAAAATTGTTTATTAACAGTCTAAAAGGGAAATTTACAACAAAGAAATTA
ATAAATTCAAAGAAAAGAAATTTAAAAAAAAGATAACTATCATTCATTCATTCATTCATT
CATTCACTCATTTTAATATTTTTTATTCACCCTTAAGATTCTTTAATTAAAAAAAATTAT
CTAAGTGTTATAATTCAGTAAAAAATTAAATGCAAAGCAAAAAGATATATTTTCAATAAT
CTATTCGAACATAGATACAATTACATACATACGTGCAAATACTTTTTTTTAATTTCTATT
TTCAGCAAGATATTAAGATAGAAATAAATTCGCAATATAAAATGAAAAAGCAACATAATT
AATTTAATAATTTGTTATAATTATTATGTAGGTATGACCATGCTTGCTTGCGCTACTTTA
CAAACTAGCCCAAGCTGGTACAATTACGATGAATGCTCAATCAACTACAACTACGTTAAC
TACCTCCTTGACTTCTCTAAAAACTAATACTCAGACTTCTTCTGCAAGGTTGTTAAAATT
ATGCTCAGTGAAAACGCTGAAGATAGACCTACTCCTTCAATTATCTACAAAATTTTGCAA
CCCTATGAGAAGGACATCTTAGCATTGAAACCCTTCAATCCTGAAAAGGAAATCATCAAG
AAATCTCTTGAATAAGAAAGCTCCTAACTCAAGGTTTCAGAATAATAAGGAGAGAAACTT
TTTGCAGACGACAACATTTTACAAAATGGCCAATAAAGCAGTGTTCAATAATCTAACTCT
CCTATTTTCGTTAAGGTTCCTTATCTTGGCGAAGATGGTAAAATCTACTACTAATAAGCT
CCCTAACAATAATTTGAATATTTGATCTAATAATCTGATGGTTAACCCATTCCTCAATTA
GAAAATCAATTCTTCTACCATGATCAATTCAACAACTAAACTAATCCTGTATATGTTAAC
GAGCCTACAAACCAAAGTGGAGTTTACGTATCTTACTCCTAACCACCTGTTCAATAAGTT
GAATACATTCAACCCAATACTGCTATCAGTGGAGTTTAATACGTCTAATCTGCTGCTCAA
CCTTAGGTTATCTTGAATGGAGCTAGACAACACTACTCTTAAGTTTTAACTCAACCTGTA
TACTAGTAAGTTTCTTATGAAAATCAATCTGCTTCAATTCCCACAGCTTCATAACTCATC
ATGAATCCTGCTCCTTAATCTGGTGTTTAATACGTATAAACTACCACTAGTCCTTACCAC
CCTGGCTAATCTCAAATTATTGCTCAATATTCTTACAATATTGAAGAAAAGCCCTTTACT
TCTATTCCTTTACAACAAAACTAAGTAGCCTACCCTCAAACTGGAGCTGAAATTACTAAT
AGCCATGTCTAAATAAATCCTATGGTTAACACTATTTAATACACTCCTATTAATAATTTA
ACTTCTAACTCTACTATTCAATAATAGTAGCCTGCTGAAGAAACTGTTAAGAAAGCTATG
CGCCAAACTCAAAGCGACTAACAAATGGTTAACTAAGATATTTATGCTAACTAGATCTAA
TACAATAATGCTCCCACTTATGGTACTACATTTGCAGCTCATGAACCTGAAAGTCCTATT
GGTATGGTTAGTGCAAACTAATATCCTTCTGAAATCAATAACACCGCTGCATTCTAAATT
GGCTCCACAACTTATGGTGGTATTAGATCAGATGCCGTCTAATCTAGTAATGCTAACTAC
CTTCCCAGTACCGTAGTTAACCAATAATACACATCCACTACTACTGGAAACAATGATATG
ATGAATGAAATAAACCGTCGTATCAATTAAGTCCTATAAAGCAGTTAAAATGTCATAAGT
AACTCTTAAGTCGGAAAATATTAATAATGA


>TTHERM_00543590(protein)
MGETNSKPQPNVDFLRVFQREYKEIGEEIDTRLGNVKVYQGPQSNLVAVKNNFLMSKELM
EEFVENNLPKALNTQNRYLMKVLSYKTHSEDSMCGSVNGITTYHEYYQNTVQDELVRRQQ
VSLYYIEQELWAILYSIVSAAYYLEKNNLIPLTDVRPSTVYFTLKGEVKLMPFGIFPEDI
SGYAKCFSQSEQSYLSPEQIEEMRKRKQVPDVNQVKSDVYSIGMTMLACATLQTSPSWYN
YDECSINYNYVNYLLDFSKNQYSDFFCKVVKIMLSENAEDRPTPSIIYKILQPYEKDILA
LKPFNPEKEIIKKSLEQESSQLKVSEQQGEKLFADDNILQNGQQSSVQQSNSPIFVKVPY
LGEDGKIYYQQAPQQQFEYLIQQSDGQPIPQLENQFFYHDQFNNQTNPVYVNEPTNQSGV
YVSYSQPPVQQVEYIQPNTAISGVQYVQSAAQPQVILNGARQHYSQVLTQPVYQQVSYEN
QSASIPTASQLIMNPAPQSGVQYVQTTTSPYHPGQSQIIAQYSYNIEEKPFTSIPLQQNQ
VAYPQTGAEITNSHVQINPMVNTIQYTPINNLTSNSTIQQQQPAEETVKKAMRQTQSDQQ
MVNQDIYANQIQYNNAPTYGTTFAAHEPESPIGMVSANQYPSEINNTAAFQIGSTTYGGI
RSDAVQSSNANYLPSTVVNQQYTSTTTGNNDMMNEINRRINQVLQSSQNVISNSQVGKYQ
Q