Identifiers and Description

Gene Model Identifier

TTHERM_00548040

Standard Name

TGL4  (TriacylGlycerol Lipase )

Aliases

PreTt15053 | 71.m00180 | 3729.m00057

Description

patatin family phospholipase; Multifunctional lipase/hydrolase/phospholipase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01734 ) phospholipase, patatin family
  • ( PF03575 ) Peptidase family S51

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

GeneMania

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17054.1 9.997093137033517e-262
Description: patatin-like phospholipase (613 aa)
Oxytricha Contig8909.0.g2 4.001839059848271e-97
Description: Domain of unknown function (DUF3336)
SGD YKR089C 1.0003926095686843e-81
Description: TGL4 Multifunctional triacylglycerol lipase, steryl ester hydrolase, and Ca2+-independent phospholipase A2; catalyzes acyl-CoA dependent acylation of LPA to PA; required with Tgl3p for timely bud formation; phosphorylated and activated by Cdc28p
Stentor Coeruleus SteCoe_32454 1.6889118802245324e-48
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00548040(coding)
ATGGTTTTTGGGCTTATTGCTCATTTTATTGAAGTAATAACAAATGAAATTGTGGAGGAT
GTTTAGATAGTAAAGGAAGTTTTAGCTTATCATATTAGCGAATTCTCTGAATACCGCTAT
CAACAAAAAGAGATGAGAAAGATAAAGTAGAAAATGAATTACTGTGATAGCTATGAAGAA
TGGGTCAGTTATTCAATTTAACATGATAGTTTGAAAGATATAACCTTATGGAAAAAAGAT
CCTACTTCACCAAATTATAATTTTGAATATATCTAGCATTTGCGTGATTAACTTAAATCA
GATAGGTTAAATAAAAATGTTCTTAAGATCATCCACACTCTCAGATCACATGCTTTCAGA
AATATTGGAAATATCTTAGATCCTCTACTTTATAAAGAATGCTTCAATGGAACTAAAGAT
TTAATTGAAGATTTCTAAAATGAAATAGATCTTTGCATTTAGTACATCGCTTCTACTTCT
TAATTATCTGTAAGAAAAAAAATGGAATTCTTCATAGAAATGAGGCATGCTGTTGGGAGA
ACTGCACTAGTATTAAGTGGCGGTGGACTCATGGGAATGTATCATGTTGGTGTTGTTAAG
ACCCTCTACGAATAAAAATTGTTGCCTAGAATTATCAGCGGTAGCTCTGCTGGAAGTATT
ATAGCAGCTTTCATATGCACCAGAAAATATGAGGAGCTGCCTTCTCTTTTCTTAACAGAT
GGAATCAACTGGCAAGCATTTTAAAAAAGAGATCCTAAAGGATAGATGATACGTAAGCTT
AAGAGATTCTTCAAAGAGGGAGTTCTACTTGATGTTAAAGTACTTTATGAGTTTACAAGA
TAAAATATTGGAGATATTACTTTTTAGGAAGCGTATGATAGAACTGGATTTATTCTGAAT
ATTACAGTTACAGGACAAGGTACTCATGATAATGACAGAGTTTTGAATTATTTAAGTGCT
CCAAATGTTATAATATGGTCAGCTGTTTGTTGCAGCTGCGGTATCCCTTACATTTATGGA
CCCAGTGATCTTCTCTGCAAAAATGAGAAAGATGAGATTGTACTTTATCTTGATAAAAAG
AAAAAATTTGTTGATGGGTCAATTGGAGCTGATCTTCCCATGCATCGCTTATCTGAATTC
TTTAATGTAAATAGTTTTATAGTCAGTTAAACAAATCCTTGGGTCGTACCATTCATGGAT
AGAGGAGAAAAGCATCCTATTGTATATCTTCCTTTCGTTAAGTTATTCAACATTATTAGA
AAACTCCTTAACTCAGAATTAAAGCACAGAGTCTAATAGCTTTCAGACTTTGATCTTCTA
CCTGGAGCTTTAAGTAAATGGGTTAATATAGTCTTGCAGACTTACGTGGGCCACATCACA
ATAGCTCCTGTACCAAGATGGAGTGACTATGCAAATGTATTGGAAGTTCCAAAGTCTAGC
GATGATTTTGAGCATTTTATGTTAGGAGGTGCTAGAAAGACATTCTCAAAGATTCCATAC
ATCAAAGCCTACATGAGGTATGAAAATAGCTTAACAAGAGGTTACAACAAAATAAAGCAA
CAGCTAGCAGAAGATTCTGGACCTATAATTCCAGTCTAAGATCCTGATGAGTCTTATGAC
AATGAAAGTATATTCATGGATGCCTTTGAAGAGGAAGAAGATATTAGAGACAAAAGAATT
AGCCTCGGGAAGAGTAAATCCATTTATGAAGACTCTAAAAGAGTTAGAAATTTCTCTTTC
ATTATTCCAAGAACTAAATCAAAAGAAGTTCTTGAAAAACTAAATAAAATAGGAGTAAAA
CCTGCTTTAGTAAGAAAGAATTCATCCTCCTCAAAAGAGTGA


>TTHERM_00548040(gene)
ATGGTTTTTGGGCTTATTGCTCATTTTATTGAAGTAATAACAAATGAAATTGTGGAGGAT
GTTTAGATAGTAAAGGAAGTTTTAGCTTATCATATTAGCGAATTCTCTGAATACCGCTAT
CAACAAAAAGAGATGAGAAAGATAAAGTAGAAAATGAATTACTGTGATAGCTATGAAGAA
TGGGTCAGTTATTCAATTTAACATGATAGTTTGAAAGATATAACCTTATGGAAAAAAGAT
CCTACTTCACCAAATTATAATTTTGAATATATCTAGCATTTGCGTGATTAACTTAAATCA
GATAGGTTAAATAAAAATGTTCTTAAGATCATCCACACTCTCAGATCACATGCTTTCAGA
AATATTGGAAATATCTTAGATCCTCTACTTTATAAAGAATGCTTCAATGGAACTAAAGAT
TTAATTGAAGATTTCTAAAATGAAATAGATCTTTGCATTTAGTACATCGCTTCTACTTCT
TAATTATCTGTAAGAAAAAAAATGGAATTCTTCATAGAAATGAGGCATGCTGTTGGGAGA
ACTGCACTAGTATTAAGTGGCGGTGGACTCATGGGAATGTATCATGTTGGTGTTGTTAAG
ACCCTCTACGAATAAAAATTGTTGCCTAGAATTATCAGCGGTAGCTCTGCTGGAAGTATT
ATAGCAGCTTTCATATGCACCAGAAAATATGAGGAGCTGCCTTCTCTTTTCTTAACAGAT
GGAATCAACTGGCAAGCATTTTAAAAAAGAGATCCTAAGTAATTAATCTAAATTTATAAA
AAAATTATTTGTGTTAAATCAGAAATTTTCTACTGAATTTTAATTACCTCCTTTCTTTTA
AAAACATTTAGTTAACTCATTTACATATTTTTTATATAAATAGAGGATAGATGATACGTA
AGCTTAAGAGATTCTTCAAAGAGGTATGCAAACAAATATATTTTTTTAATTACCTTTGTT
TTCTTTTCTCTTACTAGCTCAATTTACTTCCTAACTTACTTACAATCATAATTTTTATTT
AAAAATCAATCAATCAATTTATTTATTTATTTGTTTTCTAATTAATTTAATTCTTTAAAA
TTTTTGTAATTCAGTAAAAATATGAAGAAATAAATGGAAAATAAAAATAAAATTTTAAAA
GGAATATGTTTCTTATTTTACACTTACATCTCAATAAAAATATGAAGCAACTGAAAATAG
AAATAAAAATTTAAAAGGAATATGTTTCTTATTTTAAATGAATATAAATATTTTAGGGAG
TTCTACTTGATGTTAAAGTACTTTATGAGTTTACAAGATAAAATATTGGAGATATTACTT
TTTAGGAAGCGTATGATAGAACTGGATTTATTCTGAATATTACAGTTACAGGACAAGGTA
CTCATGATAATGACAGAGTTTTGAATTATTTAAGTGCTCCAAATGTTATAATATGGTCAG
CTGTTTGTTGCAGCTGCGGTATCCCTTACATTTATGGACCCAGTGATCTTCTCTGCAAAA
ATGAGAAAGATGAGATTGTACTTTATCTTGATAAAAAGAAAAAATTTGTTGATGGGTCAA
TTGGAGCTGATCTTCCCATGCATCGCTTATCTGAATTCTTTAATGTAAATAGTTTTATAG
TCAGTTAAACAAATCCTTGGGTCGTACCATTCATGGATAGAGGAGAAAAGCATCCTATTG
TATATCTTCCTTTCGTTAAGTTATTCAACATTATTAGAAAACTCCTTAACTCAGAATTAA
AGCACAGAGTCTAATAGCTTTCAGACTTTGATCTTCTACCTGGAGCTTTAAGTAAATGGG
TTAATATAGTCTTGCAGGTTTTATTTTTTCTACTTTTATTTTATAAGGTTTTCTACAAGT
TAAACATAAAAGATTTTAATTTTATTTAATTAAAGAATAAAAATAGCTGAAAGTTGAAAG
TTATTTTTATCTCAATTGAAATTAAATATTTTATTTTTTTAAATAAATTTTAAACAAATC
ACAAATTAAATATAAAAACTAAAATAATTATTGTTTTCATTCATAGTTGTTTTCCTTACA
ACTGATATTTATTAAATAAAATAAGTAAATTTTTTACAATTAAAAATGACTTTTTTATCA
AATATACTAGACTTACGTGGGCCACATCACAATAGCTCCTGTACCAAGATGGAGTGACTA
TGCAAATGTATTGGAAGTTCCAAAGTCTAGCGATGATTTTGAGCATTTTATGTTAGGAGG
TGCTAGAAAGACATTCTCAAAGATTCCATACATCAAAGCCTACATGAGGTATGAAAATAG
CTTAACAAGAGGTTACAACAAAATAAAGCAACAGCTAGCAGAAGATTCTGGACCTATAAT
TCCAGTCTAAGATCCTGATGAGTCTTATGACAATGAAAGTATATTCATGGATGCCTTTGA
AGAGGAAGAAGATATTAGAGACAAAAGAATTAGCCTCGGGAAGAGTAAATCCATTTATGA
AGACTCTAAAAGAGTTAGAAATTTCTCTTTCATTATTCCAAGAACTAAATCAAAAGAAGT
TCTTGAAAAACTAAATAAAATAGGAGTAAAACCTGCTTTAGTAAGAAAGAATTCATCCTC
CTCAAAAGAGTGA


>TTHERM_00548040(protein)
MVFGLIAHFIEVITNEIVEDVQIVKEVLAYHISEFSEYRYQQKEMRKIKQKMNYCDSYEE
WVSYSIQHDSLKDITLWKKDPTSPNYNFEYIQHLRDQLKSDRLNKNVLKIIHTLRSHAFR
NIGNILDPLLYKECFNGTKDLIEDFQNEIDLCIQYIASTSQLSVRKKMEFFIEMRHAVGR
TALVLSGGGLMGMYHVGVVKTLYEQKLLPRIISGSSAGSIIAAFICTRKYEELPSLFLTD
GINWQAFQKRDPKGQMIRKLKRFFKEGVLLDVKVLYEFTRQNIGDITFQEAYDRTGFILN
ITVTGQGTHDNDRVLNYLSAPNVIIWSAVCCSCGIPYIYGPSDLLCKNEKDEIVLYLDKK
KKFVDGSIGADLPMHRLSEFFNVNSFIVSQTNPWVVPFMDRGEKHPIVYLPFVKLFNIIR
KLLNSELKHRVQQLSDFDLLPGALSKWVNIVLQTYVGHITIAPVPRWSDYANVLEVPKSS
DDFEHFMLGGARKTFSKIPYIKAYMRYENSLTRGYNKIKQQLAEDSGPIIPVQDPDESYD
NESIFMDAFEEEEDIRDKRISLGKSKSIYEDSKRVRNFSFIIPRTKSKEVLEKLNKIGVK
PALVRKNSSSSKE