Identifiers and Description

Gene Model Identifier

TTHERM_00548160

Standard Name

PRE4 (20S proteasome core beta subunit 7)

Aliases

PreTt15065 | 71.m00192 | 3729.m00069

Description

PRE4 proteasome subunit beta type protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • 17-beta-hydroxysteroid dehydrogenase (NADP+) activity (IEA) | GO:0072582

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17059.1 7.999597868332553e-175
Description: proteasome A-type and B-type family protein (251 aa)
Oxytricha Contig22487.0.g85 9.99860868304602e-64
Description: Proteasome subunit
DictyBase DDB_G0273163 1.000499495426459e-47
Description: psmB4-1 on chromosome: 2 position 2482779 to 2484020
SGD YFR050C 1.9998323414791308e-36
Description: PRE4 Beta 7 subunit of the 20S proteasome
WormBase WBGene00003953 1.9996410647472548e-29
Description: locus:pbs-7 status:Confirmed UniProt:P90868 protein_id:CAB03081.1
Stentor Coeruleus SteCoe_9184 2.3802664086944007e-26
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00548160(coding)
ATGGCCTTTTACGTTTGCAAAAATAAAGAAAAAATGCATTATAGCGAATTAGCCTTAAAT
GAAAGCTAGGCTAAAAAGCACACCTTGAATCCAATCACTACAGGCTCCAGCGTTATTGGT
ATAGCTTTTAACGGTGGTGTAATTATTGCATCTGATACTTCTATTTCTTATGGTGGTATG
TCAAGATACAATCACATTTAGCGTGTTCATAAAATCACTGACAACTGTGCATTTGCTTCA
AGTGGAGAATTTTCTGATTTTTAGGAACTCTCTCGTTTAATTGATGAAATGACTAATCAA
ACTTACTTAAACGACGATAAGATCAACTACACTCCTCGTGACTATGGTAATTACATCTCT
CAATTATAATATCACCACAGAAATAAGATGAATCCTTTATACCTTTGGAACGTCATCGGA
GGTGTTGATAATGGCAAGCCATATCTTGCTCATATAGATCTTTATGGCACATATATTGAA
ACTAATCACGTTTCAACTGGATTTGGTAACTACCTTTGCGGACCTCTCTTCGAAAAAGGA
TGGAGAGCTGACATGAGTGAATAAGAAGCTAAGTAACTAGTAAACACTTGTTTCTAAGCT
CTCTTCTACAGAGACGCTAGAGCTCATGAAACAATTTAAGTCACAGTTATTGATAAAAAC
GGAGTCCGCATTGAATAACCTTACGAAATCGAATCTAAATGGGACTATTAAGGTTACGTA
AATCGTGCTAACGAAAAAATACACAATTAGTGA


>TTHERM_00548160(gene)
ATGGCCTTTTACGTTTGCAAAAATAAAGAAAAAATGCATTATAGCGAATTAGCCTTAAAT
GAAAGCTAGGCTAAAAAGCACACCTTGAATCCAATCACTACAGGCTCCAGCGTTATTGGT
ATAGCTTTTAACGGTGGTGTAATTATTGCATCTGATACTTCTATTTCTTATGGTGGTATG
TCAAGATACAATCACATTTAGCGTGTTCATAAAATCACTGACAACTGTGCATTTGCTTCA
AGTGGAGAATTTTCTGATTTTTAGGAACTCTCTCGTTTAATTGATGAAATGACTAATCAA
ACTTACTTAAACGACGATAAGATCAACTACACTCCTCGTGACTATGGTAATTACATCTCT
CAATTATAATATCACCACAGAAATAAGATGAATCCTTTATACCTTTGGAACGTCATCGGA
GGTGTTGATAATGGCAAGCCATATCTTGCTCATATAGATCTTTATGGCACATATATTGAA
ACTAATCACGTTTCAACTGGATTTGGTAACTACCTTTGCGGACCTCTCTTCGAAAAAGGA
TGGAGAGCTGACATGAGTGAATAAGAAGCTAAGTAACTAGTAAACACTTGTTTCTAAGCT
CTCTTCTACAGAGACGCTAGAGCTCATGAAACAATTTAAGTCACAGTTATTGATAAAAAC
GGAGTCCGCATTGAATAACCTTACGAAATCGAATCTAAATGGGACTATTAAGGTTACGTA
AATCGTGCTAACGAAAAAATACACAATTAGTGA


>TTHERM_00548160(protein)
MAFYVCKNKEKMHYSELALNESQAKKHTLNPITTGSSVIGIAFNGGVIIASDTSISYGGM
SRYNHIQRVHKITDNCAFASSGEFSDFQELSRLIDEMTNQTYLNDDKINYTPRDYGNYIS
QLQYHHRNKMNPLYLWNVIGGVDNGKPYLAHIDLYGTYIETNHVSTGFGNYLCGPLFEKG
WRADMSEQEAKQLVNTCFQALFYRDARAHETIQVTVIDKNGVRIEQPYEIESKWDYQGYV
NRANEKIHNQ