Identifiers and Description

Gene Model Identifier

TTHERM_00551070

Standard Name

HPL7 (Heterochromatin Protein 1 Like 7)

Aliases

PreTt29211 | 72.m00134

Description

HPL7 heterochromatin protein; Heterochromatin protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • obsolete signal peptidase I activity (IEA) | GO:0009004
  • PLC activating G protein-coupled glutamate receptor activity (IEA) | GO:0001639

Biological Process

Domains

  • ( PF00385 ) 'chromo' (CHRromatin Organization MOdifier) domain
  • ( PF06658 ) Protein of unknown function (DUF1168)

Gene Expression Profile

Tetrahymena Stock Center

  • ( SD02326 ) Macronucleus: Neo4 upstream and 2 HA tags inserted after the ATG of TCD2
  • ( SD02327 ) Macronucleus: Neo4 upstream and 2 HAtags inserted after the ATG of TCD2
  • ( SD02495 ) Macronucleus: Two HA tags after ATG of TCD2, neo4 in 5’ flank, inserted into MTT1 locus for over expression, need Cd
  • ( SD02496 ) Macronucleus: Two HA tags after ATG of TCD2, neo4 in 5’ flank, inserted into MTT1 locus for over expression, need Cd
  • ( SD02506 ) Macronucleus: TCD2 was knocked out with neo4, then the wt TCD2 gene with a bsr1cassette upstream was somatically reintroduced into the cell
  • ( SD02507 ) Macronucleus: TCD2 was knocked out with neo4, then the wt TCD2 gene with a bsr1cassette upstream was somatically reintroduced into the cell

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07338.1 2.0007019863683806e-141
Description: heterochromatin protein (422 aa)
DictyBase DDB_G0283023 0.0000009995106777214876
Description: hcpA on chromosome: 4 position 170065 to 170742
WormBase WBGene00001995 0.000005000363240844623
Description: locus:hpl-1 status:Confirmed UniProt:G5EET5 protein_id:CAA94152.1
Oxytricha Contig9832.0.g37 0.00003998524687536623
Description: Chromo (CHRromatin Organisation MOdifier) domain

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28692189: Wiley EA, Horrell S, Yoshino A, C Schornak C, Bagnani C, L Chalker D (2017) Diversification of HP1-like Chromo Domain Proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology ( ):

Sequences

>TTHERM_00551070(coding)
ATGAAAAAGAGAAGACAATCAACAAATAATGAAAAGCAGGAAGATCTTTATGAACCTGAA
AAGATATTAGATAAAAAAGTTAATTAAAGTGGTACTTCCTATTTGGTTAAATGGAAAGGT
TTTAGGGCTTCACAAGCAACATGGGAATTTTATAAAAACATATCTCATTGCAATTGGCTT
TTTGAAGATTGGGAAGAGTAGTAAAATAGAAAGGAATTACAAAAAATCAAGAATATGGAT
AGGATAATAGACAAAAAATATGTAAATAGTAAAGTTTTTTATTTGGTTTCTCTAAAAAAT
GGCGGAGAAGATGTATGGATTAGAAGAAAGGCTTTGATGCTTGACCATGCCGATAAAATT
TCTGAATATGAAAAGAGTGATTAATTGGTTGGGGCTAAAAGAAAATATTAATAGAAAAGA
TTTAGCAAAAGCTAAGATAGATTTCTTAGCAGTGATGAAGATTTGAGCGATTCTTAAAGT
GATAAAAATTCAGATAATAGCTAAAATAATTCAAGCAATAGCGATAATAGTTAAAGTAGA
AGCGGAAGCAGTTCAGATTCATGCAGTAGAAGCTCTTCAGAAGATAATTAAGATGAAAAT
ACAAATTAAAGAGGAAAAAGTAATGGTAGAAGAAAGGGTAGAATTTATAACAATAAAAAA
AAACCGAAGAGAGGAGGAAATAGAAAAAATTAAAAAGGATAGAATATTAATGATTCAAAT
AGTAGCTCAGATGAGAATAGTGAGCAAGAAGTCTCTGAATCAAGAAGAATAGTTAAAACA
AAAAGAAAAATTCCAAAAAAATGCAAAATTTTATATGATAAGCTTCCTTTTTATGGTATA
CTTGGTATAGATGAACCAAAATCTATAAAAAATATGGTCATAGACAAAAGAGTAGGGACG
AAGGATGATGGATATTTTGCTTGTGATATTATTTGGAAAATTAGACCTAATAAACAATAG
CCTGTCGATAGTAGAGTCAGCAGAAAAGATATAAAAGAGTTCTATCCTCTTATTTTAATA
GAATTTTATGAGTATAATATGACATATAATGGTGAAGTAGTCAATGCTGATGATGAAGAT
GACTTAGAATATTACAATGGTGATGATGAAGAAGATGCTGATCATGATGATGAGTATTAT
TAAAAATTATAAAGAAAAGCTGGTAAAAAACCTCTTGAAAACGAAAACTCAGAAGCTGAT
AATTAGGATGAAAAATCTGAAGATTCATTTAGCTTTTAGAATTAGATTTACTATGGGTAT
GCTAAAACTAATGAATAGAAAAAGTATGTTAAATTTGATGAAAAATTCTTCAACAACAAT
CAAATGGAAGAAATGTGA


>TTHERM_00551070(gene)
ATGAAAAAGAGAAGACAATCAACAAATAATGAAAAGCAGGAAGATCTTTATGAACCTGAA
AAGATATTAGATAAAAAAGTTAATTAAAGTGGTACTTCCTATTTGGTTAAATGGAAAGGT
TTTAGGGCTTCACAAGCAACATGGGTAAATACATAAATTTATTTCCATAATTAGAGCTCA
ATAAAAAATGTGTTATTATAAACCAGGAATTTTATAAAAACATATCTCATTGCAATTGGC
TTTTTGAAGATTGGGAAGAGTAGTAAAATAGAAAGGAATTACAAAAAATCAAGAATATGG
ATAGGATAATAGACAAAAAATATGTAAATAGTAAAGTTTTTTATTTGGTTTCTCTAAAAA
ATGGCGGAGAAGATGTATGGATTAGAAGAAAGGCTTTGATGCTTGACCATGCCGATAAAA
TTTCTGAATATGAAAGTAATTATTTTGAAGATTTAAATTTCTTTTACATTTATTTATATT
TGATTTATATAAAGAGAGTGATTAATTGGTTGGGGCTAAAAGAAAATATTAATAGAAAAG
ATTTAGCAAAAGCTAAGATAGATTTCTTAGCAGTGATGAAGATTTGAGCGATTCTTAAAG
TGATAAAAATTCAGATAATAGCTAAAATAATTCAAGCAATAGCGATAATAGTTAAAGTAG
AAGCGGAAGCAGTTCAGATTCATGCAGTAGAAGCTCTTCAGAAGATAATTAAGATGAAAA
TACAAATTAAAGAGGAAAAAGTAATGGTAGAAGAAAGGGTAGAATTTATAACAATAAAAA
AAAACCGAAGAGAGGAGGAAATAGAAAAAATTAAAAAGGATAGAATATTAATGATTCAAA
TAGTAGCTCAGATGAGAATAGTGAGCAAGAAGTCTCTGAATCAAGAAGAATAGTTAAAAC
AAAAAGAAAAATTCCAAAAAAATGCAAAATTTTATATGATAAGCTTCCTTTTTATGGTAT
ACTTGGTATAGATGAACCAAAATCTATAAAAAATATGGTCATAGACAAAAGAGTAGGGAC
GAAGGATGATGGATATTTTGCTTGTGATATTATTTGGAAAATTAGACCTAATAAACAATA
GCCTGTCGATAGTAGAGTCAGCAGAAAAGATATAAAAGAGTTCTATCCTCTTATTTTAAT
AGAATTTTATGAGTATAATATGACATATAATGGTGAAGTAGTCAATGCTGATGATGAAGA
TGACTTAGAATATTACAATGGTGATGATGAAGAAGATGCTGATCATGATGATGAGTATTA
TTAAAAATTATAAAGAAAAGCTGGTAAAAAACCTCTTGAAAACGAAAACTCAGAAGCTGA
TAATTAGGATGAAAAATCTGAAGATTCATTTAGCTTTTAGAATTAGATTTACTATGGGTA
TGCTAAAACTAATGAATAGAAAAAGTATGTTAAATTTGATGAAAAATTCTTCAACAACAA
TCAAATGGAAGAAATGTGA


>TTHERM_00551070(protein)
MKKRRQSTNNEKQEDLYEPEKILDKKVNQSGTSYLVKWKGFRASQATWEFYKNISHCNWL
FEDWEEQQNRKELQKIKNMDRIIDKKYVNSKVFYLVSLKNGGEDVWIRRKALMLDHADKI
SEYEKSDQLVGAKRKYQQKRFSKSQDRFLSSDEDLSDSQSDKNSDNSQNNSSNSDNSQSR
SGSSSDSCSRSSSEDNQDENTNQRGKSNGRRKGRIYNNKKKPKRGGNRKNQKGQNINDSN
SSSDENSEQEVSESRRIVKTKRKIPKKCKILYDKLPFYGILGIDEPKSIKNMVIDKRVGT
KDDGYFACDIIWKIRPNKQQPVDSRVSRKDIKEFYPLILIEFYEYNMTYNGEVVNADDED
DLEYYNGDDEEDADHDDEYYQKLQRKAGKKPLENENSEADNQDEKSEDSFSFQNQIYYGY
AKTNEQKKYVKFDEKFFNNNQMEEM