Identifiers and Description

Gene Model Identifier

TTHERM_00554190

Standard Name

TDH2 (glyceraldehyde-3-phosphate dehydrogenase)

Aliases

PreTt29226 | 72.m00149

Description

TDH2 glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase- type I family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF00044 ) Glyceraldehyde 3-phosphate dehydrogenase, NAD binding
  • ( PF01113 ) Dihydrodipicolinate reductase, N-terminus
  • ( PF02800 ) Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
  • ( TIGR01532 ) D-erythrose-4-phosphate dehydrogenase
  • ( TIGR01534 ) glyceraldehyde-3-phosphate dehydrogenase, type I

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07327.1 9.997093137033517e-262
Description: glyceraldehyde-3-phosphate dehydrogenase, type I family protein (343 aa)
Oxytricha Contig18741.0.g63 6.999124466619517e-162
Description: Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
DictyBase DDB_G0275153 3.000455015819344e-150
Description: gpdA on chromosome: 2 position 5324765 to 5325948
WormBase WBGene00001686 2.000851114308011e-136
Description: locus:gpd-4 Glyceraldehyde-3-phosphate dehydrogenase 4 status:Confirmed UniProt:P17331 protein_id:CAA88697.1
SGD YJL052W 1.0002323021920326e-132
Description: TDH1 Glyceraldehyde-3-phosphate dehydrogenase, isozyme 1, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell wall
Stentor Coeruleus SteCoe_978 3.5722699376192174e-67
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00554190(coding)
ATGTCTTTAAGAATAGGTATAAACGGATTTGGTAGAATAGGCAGATTAGTTTTAAGAGCT
GCTATTGAAAATAAATCTAATTTGATCACACCTGTTGCAATTAATGATCCTTCTATGGAT
ATTGATTATTTAATTTATTAATTAAAATATGACTCAGTTCATCTAAAATTTCCTGGCACT
ATTGAAAAGGTTAATGAACATACTGTTAAAATAAATGGAAATTCTATTGTCTTGTTTAAA
GAAAAGGATCCTGCTGCTTTAAAATGGGGTGAAGTGGGAGCTGATTTTATATGCGAGTCA
TCAGGATTATTTTTGACTTAAGATAAAGCTGGAGCTCACTTAAAAGGAGGTGCTAAGAAA
GTTATTTTATCAGCACCTTCTAAAGATGATACTCCTACTTATGTCTTTGGTGTCAATCAT
AATAATTATATACCTTCTTAAAATATCATTTCTAATGCCTCTTGCACTACAAATTGTTTA
GCAAATATCGCTAAGGTACTTGACTAAAATTTTGGTATAGTAGAAGGTTTAATGACAGCT
GTGCATGCTACAACAGCTTCTCAATAAGTGGTTGATGGTCCTTCAAAAGGAGGAAAAGAT
TGGAGAGCTGGAAGAGCTGCAAAGGTTAACATTATTCCTTCTTCTACAGGTGCTGCAAAA
GCTGTTGGTCTGGTTCTACCAAATCTTAAAGGAAAACTTACTGGGATGTCATTTAGAGTT
CCTACTATTGATGTGTCTGTAGTAGATCTAACTGTTAGACTTGAAAAAAAAACTACATAT
GCAAATATTTGTGAGGCTATGGAAGAAGCTTCTAAAGGTGAGCTTAATGGAATTTTAGGT
TATACAAAAGATGAAGTAGTATCTTAAGATTTCGTACATGATTAGAGAACTTCTATTTTT
GATTCAAAAGCAGGAATTGGTCTGAACAATAATTTTTTTAAAGTTGTATCTTGGTATGAT
AATGAATGGGGATTTTCAAACAAGCTTCTTGATTTAGCTTTGCATGTTTAAAAAACTTCA
GGATTATGA


>TTHERM_00554190(gene)
ATGTCTTTAAGAATAGGTATAAACGGATTTGGTAGAATAGGCAGATTAGTTTTAAGAGCT
GCTATTGAAAATAAATCTAATTTGATCACACCTGTTGCAATTAATGATCCTTCTATGGAT
ATTGATTATTTAATTTATTAATTAAAATATGACTCAGTTCATCTAAAATTTCCTGGCACT
ATTGAAAAGGTAGTTAGAATAATTACAATAATTTTAACAAATGCATAAAAATACCCTTCA
AATCTATATTTTAATGCTTATTTTTATTTTATTCTATTCTAATAAATTTACTTTGAATAA
TATATGCACTTAAACTTCAATTTAAGTTAAATTTTATCTGTTTTAATTTTATTTTTAAAT
AGGTTAATGAACATACTGTTAAAATAAATGGAAATTCTATTGTCTTGTTTAAAGAAAAGG
ATCCTGCTGCTTTAAAATGGGGTGAAGTGGGAGCTGATTTTATATGCGAGTCATCAGGAT
TATTTTTGACTTAAGATAAAGCTGGAGCTCACTTAAAAGGAGGTGCTAAGAAAGTTATTT
TATCAGCACCTTCTAAAGATGATACTCCTACTTATGTCTTTGGTGTCAATCATAATAATT
ATATACCTTCTTAAAATATCATTTCTAATGCCTCTTGCACTACAAATTGTTTAGCAAATA
TCGCTAAGGTACTTGACTAAAATTTTGGTATAGTAGAAGGTTTAATGACAGCTGTGCATG
CTACAACAGCTTCTCAATAAGTGGTTGATGGTCCTTCAAAAGGAGGAAAAGATTGGAGAG
CTGGAAGAGCTGCAAAGGTTAACATTATTCCTTCTTCTACAGGTGCTGCAAAAGCTGTTG
GTCTGGTTCTACCAAATCTTAAAGGAAAACTTACTGGGATGTCATTTAGAGTTCCTACTA
TTGATGTGTCTGTAGTAGATCTAACTGTTAGACTTGAAAAAAAAACTACATATGCAAATA
TTTGTGAGGCTATGGAAGAAGCTTCTAAAGGTGAGCTTAATGTAATTTATTATTTATTTG
TCTCCCTTTTTAATTTGTTTAAATACATTAAAATTAAAAAGGGAATTTTAGGTTATACAA
AAGATGAAGTAGTATCTTAAGATTTCGTACATGATTAGAGAACTTCTATTTTTGATTCAA
AAGCAGGAATTGGTCTGAACAATAATTTTTTTAAAGTTGTATCTTGGTATGATAATGAAT
GGGGATTTTCAAACAAGCTTCTTGATTTAGCTTTGCATGTTTAAAAAACTTCAGGATTAT
GA


>TTHERM_00554190(protein)
MSLRIGINGFGRIGRLVLRAAIENKSNLITPVAINDPSMDIDYLIYQLKYDSVHLKFPGT
IEKVNEHTVKINGNSIVLFKEKDPAALKWGEVGADFICESSGLFLTQDKAGAHLKGGAKK
VILSAPSKDDTPTYVFGVNHNNYIPSQNIISNASCTTNCLANIAKVLDQNFGIVEGLMTA
VHATTASQQVVDGPSKGGKDWRAGRAAKVNIIPSSTGAAKAVGLVLPNLKGKLTGMSFRV
PTIDVSVVDLTVRLEKKTTYANICEAMEEASKGELNGILGYTKDEVVSQDFVHDQRTSIF
DSKAGIGLNNNFFKVVSWYDNEWGFSNKLLDLALHVQKTSGL