Identifiers and Description

Gene Model Identifier

TTHERM_00554600

Standard Name

CPH3 (homolog of CAP-H or BRN1 condensin gene)

Aliases

PreTt29267 | 72.m00190

Description

condensin complex subunit 2; condensin subunit- kleisin

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07309.1 9.997093137033517e-262
Description: hypothetical protein (774 aa)
Oxytricha Contig18145.0.g34 2.998577119979921e-31
Description: Condensin complex subunit 2
DictyBase DDB_G0292066 7.996806159126539e-24
Description: ncapH on chromosome: 6 position 1141212 to 1144129
SGD YBL097W 0.00000000000004998767099442072
Description: BRN1 Subunit of the condensin complex; required for chromosome condensation and for clustering of tRNA genes at the nucleolus; may influence multiple aspects of chromosome transmission
Stentor Coeruleus SteCoe_31169 0.0000000001026187963170189
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29237819: Howard-Till R, Loidl J (2018) Condensins promote chromosome individualization and segregation during mitosis, meiosis, and amitosis in Tetrahymena thermophila. Molecular biology of the cell 29(4):466-478

Sequences

>TTHERM_00554600(coding)
ATGGGTAAACCTTTAAGCGAGAAGCAAGTGAATTCATCCTAAAATTCACAAAATGCCCCT
AACTCGAGGGAAAAGTTTTTAGGAGCAAGCAAAAAAATAGCTAAAAAAAAGAAGGAAGTT
TCGCTGGACTTAGAAACCAATTAGGAAGAAGGGTTAGATTCCTTGAAGCTGCAATAGCAA
TCCAAGAAAGAAACATCAAAAGAAATAATATAAAGAAGGTAGAATTTATATGATAGGGAA
GAAGATGAGGAAATAGAAGAGGAATACAACATTGAAGATGCAAAATTGGCTAAAAACTCT
AATTAAGATAAAATCAGCGACATAATTGTAGGCCTTTTGTTAAAAAACAAAATCAACTCA
AAAAATGCATTTGAAGTCCCTGTTGTAAATGTTTTAGATCTCTCTGATTTTAAAAACATA
AATACAGATTTTGCTTGGAAGAAGCTCTCAAGCACTCTTGATGCAGGTGCAAGGATTTAT
GGATATCGTGTAGACAGTTTGCATAGTGACACTTATAAAATAAGAGGAGGCCTTAATCGC
TCAGAGGTTTAAGACATAAAAGATGCTAATAAAGCAAATGATTTAGAAGACCCACTTGAA
AAAGATGAAGAAATAGAAAAGAAATTGCAAAAGAAGAAATTCAAAGGAGGTGAGAGCACT
TTAGAAAAGAACTTAGCGAATATCAATGCCACCAAATACGATTTAGAATTCGACATTGAT
CCTCTATTTCAAAAAACCTCTGCAAAATTTGATGACTCAGGAGCTAAAGGACTTCTTATG
AATGCTATAGGAATAGATTCTGATGTCTCAATTTTGCTTGACTCATCTAAGCAGTAGCAA
CTTTGGAAGAGAAGAAAGCAAAAAAAAGCAACTTATGGTGAAATAGCAAGTTTAAATAGT
GGTAAACCAACAAATTATGAGAGTATCTTTAAGTGCTAGCTTTGTCCCGAAATGACTAAT
TTGGCTCTAGACATGAGAAATAATTCAAAGCAGATCTTTGATGTGTCAAGAATAAGAGAA
AACAGGAGAACAAACTTCTTGATTTCTACAAACTCTGAAATTTCAATGTAAAATAAGCTT
ATAAACGAAATAGAAGAAGGTGAGAGAGAAATCATGCAAGAAATTGATGCAGCTATTTTG
AATTAGGTTGATGATTATTTAGAACCTCTTGAAAAAGAGTAAATACTCTTATAAGATAAT
CCTGCTTCATTCAATGCTGCAAATCTTTCAAACAGCTTTAATCATAACTTGATAACCACC
AATCCTCATGGATACGACGACTACAACGATTAAATAATTCCAGAGTAAGATGATATTCCT
CTTGAAGATGTATATAACGAAAAGAATGCATTAAACCTTGACAAATTCAATTCAATCGAA
GAAGAGCATGACAATACAATTACAGCATTAATTGGCGGAGGAGCTGCCACACTCAACACA
TCTATGAACTCACAGTCTATGAAGCCCCTTAACTTTTTGAATTTAGAAGATAAGTTGCAG
ACAATTGGATTTGGGAAAGAATATATGAATGGATCAAGCATAAAGAATTGGATGCAACCT
GATGCATGGAAATTACCAAAAAAGTAAAACATCAAAATACGCATTTAGGACTTACTCCCA
GAGCTTAACATATTCAGGTCAAAAAAGCTAAAACAAAAGGGTGAGTGCGAAATTGACTTC
GACATCTCAAATGAAGAAGACTTTGATCAAGTTGTTGATCCCGATCCAATTAATGTAGAT
AAATATAAGAGTTCATATTCTTAAGAAATTGGGATGCTCCCAAAAGATTATCACATCTCT
AAGCAATTATTGAGCTCTTTTGGATTTAAAGATCCTGCTACCATATTCCATCGCTCTCGT
CTTGGAAGTGAATTAGATGAAGATGATCTAAATAACGACACAATTGACTACTACGATTAC
AACGGTGATAACAGAATATTGCCTGTAAATACCCATGTTCCCAGTACTATGTCAAAAGTG
CTGAATGAAATTGCAGAAAAATAGGCAATTAAGGCAAAGAACTAAATGCCCATCAAAGAG
CTCAAGACAAAACTATGGGACAAGCTGGAAAAAAAGATACCAATGACTTCAACCACAGGA
TAGAGCCAAAACGACTCTCTTTTCATCCAAAAAAGAGTTGAAGTTGAGGAAGAAGAAATT
CATTTTAGTGATGTTTACGATCAACTCCCTGACTTGATAGGCCTTCAAAATCGTAGCAGA
GTCTCTCTCTAAACATGCTTCGTTACAATTCTTCATCTTGCAAACGAAAAGACTCTCCGT
TTCGAGAGAACTGAGAGAGAAGGTGATTTCAAAATATCAAGAGACTAGAATTGA


>TTHERM_00554600(gene)
ATGGTAGGTTTATTTATTTTAAATGATATTCAAAACAAATAGGACCTTTTATTTTCTAAA
AACTATAGGGTAAACCTTTAAGCGAGAAGCAAGTGAATTCATCCTAAAATTCACAAAATG
CCCCTAACTCGAGGGAAAAGTTTTTAGGAGCAAGCAAAAAAATAGCTAAAAAAAAGAAGG
AAGTTTCGCTGGACTTAGAAACCAATTAGGAAGAAGGGTTAGATTCCTTGAAGCTGCAAT
AGCAATCCAAGAAAGAAACATCAAAAGAAATAATATAAAGAAGGTAGAATTTATATGATA
GGGAAGAAGATGAGGAAATAGAAGAGGAATACAACATTGAAGATGCAAAATTGGCTAAAA
ACTCTAATTAAGATAAAATCAGCGACATAATTGTAGGCCTTTTGTTAAAAAACGTAATAC
ATATTTCTTATAAATTCAAATTTTAGAATTTTTTGTTAGCTTTGTTTTTTTTCTTGTCAT
TCATCAAAAATCTTATTATCATTAAAGAAAATCAACTCAAAAAATGCATTTGAAGTCCCT
GTTGTAAATGTTTTAGATCTCTCTGATTTTAAAAGTAAGCATTGTTTTTATGAGGAAGAA
ATACTTCTTCTAAAACACATATTTTTAATATAATTTTTGTTAAAAAAGACATAAATACAG
ATTTTGCTTGGAAGAAGCTCTCAAGCACTCTTGATGCAGGTGCAAGGATTTATGGGTATG
CTAATTAACGGATTTTAATTTTAATAATATTTAAATACAAACAAAAGATATCGTGTAGAC
AGTTTGCATAGTGACACTTATAAAATAAGAGGAGGCCTTAATCGCTCAGAGGTTTAAGAC
ATAAAAGGTAGTTAAGTTATTTATACATTATATAGTTGATTCTATAATAATATATATTAT
ATAGATGCTAATAAAGCAAATGATTTAGAAGACCCACTTGAAAAAGATGAAGAAATAGAA
AAGAAATTGCAAAAGAAGAAATTCAAAGGAGGTGAGAGCACTTTAGAAAAGAACTTAGCG
AATATCAATGCCACCAAATACGATTTAGAATTCGACATTGATCCTCTATTTCAAAAAACC
TCTGCAAAATTTGATGACTCAGGAGCTAAAGGACTTCTTATGAATGCTATAGGAGTATTT
ATTATTAAAATTTCAAATTATAAGAAAAATGAATAACAATGAAATAATCTTTAAAATAGA
TAGATTCTGATGTCTCAATTTTGCTTGACTCATCTAAGCAGTAGCAACTTTGGAAGAGAA
GAAAGCAAAAAAAAGCAACTTATGGTGAAATAGCAAGTTTAAATAGTGGTAAATAAAACT
AATAAGCAAATAATCGCTATGTATTTATTCTGAATTTTTTTTATCTAGGTAAACCAACAA
ATTATGAGAGTATCTTTAAGTGCTAGCTTTGTCCCGAAATGACTAATTTGGCTCTAGACA
TGAGAAATAATTCAAAGCAGATCTTTGATGTGTCAAGAATAAGAGAAGTAAAATAAATTA
TTTCAAAATATTAACATGATTAAATTGCTTAAAATTAATTTTATACAAATGCATTTATTT
GACTTATTTTTAAAATAATTTCCAGAACAGGAGAACAAACTTCTTGATTTCTACAAACTC
TGAAATTTCAATGTAAAATAAGCTTATAAACGAAATAGAAGAAGGTGAGAGAGAAATCAT
GCAAGAAATTGATGCAGCTATTTTGAATTAGGTTGATGATTATTTAGAACCTCTTGAAAA
AGAGTAAATACTCTTATAAGATAATCCTGCTTCATTCAATGCTGCAAATCTTTCAAACAG
CTTTAATCATAACTTGATAACCACCAATCCTCATGGATACGACGACTACAACGATTAAAT
AATTCCAGAGTAAGATGATATTCCTCTTGAAGATGTATATAACGAAAAGAATGCATTAAA
CCTTGACAAATTCAATTCAATCGAAGAAGAGCATGACAATACAATTACAGCAGTAGAGAA
TATTTTTAATTTCTTAACTTTTAACAATGCTAAATAAATAAATTAATAAATAATTCAAAT
AAAAAGTTAATTGGCGGAGGAGCTGCCACACTCAACACATCTATGAACTCACAGTCTATG
AAGCCCCTTAACTTTTTGAATTTAGAAGATAAGTTGCAGACAATTGGATTTGGGAAAGAA
TATATGAATGGATCAAGCATAAAGAATTGGATGCAACCTGATGCATGGAAATTACCAAGT
AATTCAAACCTCTATTTTAATTTTATTAAACAAATAGAGATATTCCTATCCTCATTCATC
AAAAAATTTATGGGGCAGGTCTTTCTTAAAATAAAAATAAAGTTTTAATATTTGTCTATT
CCACGAGGAATAATATGATCGGAACCTGATTAGGTGTTTTTAATTAGAATTTATAAGAAA
ACTCATAGAAATTTTGTGAAAGAATTTATCATTAACACTTTAATCAAAGAGCGATTTTAT
TTTTAATACTTCACAATTTATAAAAAGAAAAGTAAAACATCAAAATACGCATTTAGGACT
TACTCCCAGAGCTTAACATATTCAGGTCAAAAAAGCTAAAACAAAAGGGTGAGTGCGAAA
TTGACTTCGACATCTCAAATGAAGAAGACTTTGATCAAGTTGTTGATCCCGATCCAATTA
ATGTAGATAAATATAAGAGTTCATATTCTTAAGAAATTGGGATGCTCCCAAAAGATTATC
ACATCTCTAAGCAATTGTAATTAATTCATTTTTGTCATTTGGTACCTTAACTTAATTTGC
TTGTGTTTGCTTAATTATTTTGAGGGGTATCGAGATTATTAATTAATTTTTATTTGTGAT
TTGTATCTAGATAATTTGTTCATCTAAGATTCGCAATTGTTTTTATAATTCAAAAGCATT
ACTTTTGCAATTAATTTTTAATCTATTATGATTGACAAGTTGCTTTAGATTAAGATTAAT
AAATTTCTTTTCTTTTTTTCAGGGTACTTTCCTTACATTAATTAAGATATAATTTTTATG
ATGCTTTATTAGAAAAATATCCTAGCATACACACCTTAACCCAACCCAGAACAATTCAAC
ACAACAATTTTTGAAAAAGATATTTTTATGAGTTCAAATAATTTTATATTTTAATTGAAA
AAATAGATTGAGCTCTTTTGGATTTAAAGATCCTGCTACCATATTCCATCGCTCTCGTCT
TGGAAGTGAATTAGATGAAGATGATCTAAATAACGACACAATTGACTACTACGATTACAA
CGGTGATAACAGAATATTGCCTGTAAATACCCATGTTCCCAGTACTATGTCAAAAGTGCT
GAATGAAATTGCAGAAGTAAGATAAATTGATTAATCATTTATAGTTACATATTTATTGTT
GTATATTGATTTTCAAAATTAGTTAAGCAAATTTGAGTTTACATTTTATAAAAAAAATGA
AGTATTGTTGTTCATTAAAATAATTTGTTTCCTTATCCATTAAAGAAATAGGCAATTAAG
GCAAAGAACTAAATGCCCATCAAAGAGCTCAAGACAAAACTATGGGACAAGCTGGAAAAA
AAGATACCAATGGTAAAAATACAAGAAATTATTTTCCAACTTGATTTGTTTGTTTGTTTG
TTAGTTATTTTTTTTTTCTTATTGACTTTCCCCAATTTATAAATTAAAATATCTAAAAGC
CCAAATTATTTGCTATTTTATTTTTTAACCACAAATTTTCACTTTGTTATTCTAATTGAA
GTTGATTTTTCAATTTTATAAAAATAAATAAAATTTTGTTTAATTCAGATAACATTTACA
TACATACCTACAATCAATTGATTTTCGGCTATATTCAAGCTAAAATTCATTTGAATATTT
ATTTATTTATCAATAAAGACTTCAACCACAGGATAGAGCCAAAACGACTCTCTTTTCATC
CAAAAAAGAGTTGAAGTTGAGGAAGAAGAAATTCATTTTAGTGATGTTTACGATCAACTC
CCTGACTTGATAGGCCTTCAAAATCGTAGCAGAGTCTCTCTCTAAACATGCTTCGTTACA
ATTCTTCATCTTGCAAACGAAAAGACTCTCCGTTTCGAGAGAACTGAGAGAGAAGGTGAT
TTCAAAATATCAAGAGACTAGAATTGA


>TTHERM_00554600(protein)
MGKPLSEKQVNSSQNSQNAPNSREKFLGASKKIAKKKKEVSLDLETNQEEGLDSLKLQQQ
SKKETSKEIIQRRQNLYDREEDEEIEEEYNIEDAKLAKNSNQDKISDIIVGLLLKNKINS
KNAFEVPVVNVLDLSDFKNINTDFAWKKLSSTLDAGARIYGYRVDSLHSDTYKIRGGLNR
SEVQDIKDANKANDLEDPLEKDEEIEKKLQKKKFKGGESTLEKNLANINATKYDLEFDID
PLFQKTSAKFDDSGAKGLLMNAIGIDSDVSILLDSSKQQQLWKRRKQKKATYGEIASLNS
GKPTNYESIFKCQLCPEMTNLALDMRNNSKQIFDVSRIRENRRTNFLISTNSEISMQNKL
INEIEEGEREIMQEIDAAILNQVDDYLEPLEKEQILLQDNPASFNAANLSNSFNHNLITT
NPHGYDDYNDQIIPEQDDIPLEDVYNEKNALNLDKFNSIEEEHDNTITALIGGGAATLNT
SMNSQSMKPLNFLNLEDKLQTIGFGKEYMNGSSIKNWMQPDAWKLPKKQNIKIRIQDLLP
ELNIFRSKKLKQKGECEIDFDISNEEDFDQVVDPDPINVDKYKSSYSQEIGMLPKDYHIS
KQLLSSFGFKDPATIFHRSRLGSELDEDDLNNDTIDYYDYNGDNRILPVNTHVPSTMSKV
LNEIAEKQAIKAKNQMPIKELKTKLWDKLEKKIPMTSTTGQSQNDSLFIQKRVEVEEEEI
HFSDVYDQLPDLIGLQNRSRVSLQTCFVTILHLANEKTLRFERTEREGDFKISRDQN