Identifiers and Description

Gene Model Identifier

TTHERM_00558010

Standard Name

CTH79 (CaTHepsin 79)

Aliases

PreTt07899 | 73.m00143 | 3735.m00037

Description

CTH79 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14365.1 9.997093137033517e-262
Description: papain family cysteine protease containing protein (378 aa)
Oxytricha Contig19008.0.g54 4.0018838296491823e-56
Description: Papain family cysteine protease
WormBase WBGene00000776 1.0004249259458435e-52
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
DictyBase DDB_G0281605 6.002971818577897e-50
Description: cfaD on chromosome: 3 position 4701100 to 4702904
Stentor Coeruleus SteCoe_27084 4.780892883885469e-25
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00558010(coding)
ATGAATAAATTAATAATATTGGCAATTGTTTTAGGCTTAACAGTTTCTTAAACCTATAAC
AGTAATTTGAAATAATACACATTCGATTAATATATCCAAGACTTCAACAAGGGATATTAA
TATGGATCTTCAGAATACTTCATGAGAAAAGCTATATTTGAATAGAAATTAGCTGAAATC
ATTGCTTTCAACGAATAAACTAATTAATCATACAAAAAGGGTGTTAACAGATTTACTGAC
TTAACAGACAGCGAATTCAAGTAAAATAGCTTAGGATACAGCAAAAACATGAGTAATGTT
AGAGCTTTCCGTAACTTATCTGTTAAGAATTTGGAAGTTACTGAATAATAATTAAAGGAA
TTACCCGTTAATGTTGATTGGAGATAAAAAGGAGTTGTTACCCCAGTTAAAGATTAAGGT
CACTGCGGTTCTTGTTGGGCTTTTGCTTCAACTGCTACTATTGAATCCTATGCAGCCATT
AACTCTGGTTAATTGAAAACTTTATCTACTCAATAACTCGTAAGTTGTGTTCCTAACCCT
TACTAATGTGGTGGTACTGGTGGTTGCAATGGTGCTATTTCCGAATTAGCATTTAACTAT
GTCTAATTATACGGTTTAACCTCTGAATTCAAATATCCTTATCAAAGTTATGTATCTGGT
GTTACTGGTAACTGTACATTCGATTCAACTTAATAAACCCCTGAAGTAGCTTTAGATGGT
TATGTCAAATTATAGGCTAACGACTACGATGCTTTACTTTATGCTCTTGCCAATATTGGT
CCTTTGGCTGTTGCTGTAGATGCTAGTCAATGGCGTAATTACCAATCTGGTGTCTTCAAC
GGATGCAGTTACACAGACAACATTGATGTAAACCACGTTGTAGTCCTTGTTGGTTACGGT
ACTGATCCTGAATTAGGTGACTATTGGTTGATTAGAAACTCATGGGGTACCAAATTCGGT
GAAAATGGTTATATCAGATTAGCTAGAGAATCTAAGGTTACTTGTGGTACTGACTATACT
CCTTTAGATGGATAAGCTTGTGCTGGCCAAAATGTCCCTACTAAGGTTTGTGGTTAATGT
GGTGTTGCTTATGATGCCGCTTATCCTACAAATGTTAGAGTAATTGGTTGA


>TTHERM_00558010(gene)
ATGAATAAATTAATAATATTGGCAATTGTTTTAGGCTTAACAGTTTCTTAAACCTATAAC
AGTAATTTGAAATAATACACATTCGATTAATATATCCAAGACTTCAACAAGGGATATTAA
TATGGATCTTCAGAATACTTCATGAGAAAAGCTATATTTGAATAGAAATTAGCTGAAATC
ATTGCTTTCAACGAATAAACTAATTAATCATACAAAAAGGGTGTTAACAGATTTACTGAC
TTAACAGACAGCGAATTCAAGTAAAATAGCTTAGGATACAGCAAAAACATGAGTAATGTT
AGAGCTTTCCGTAACTTATCTGTTAAGAATTTGGAAGTTACTGAATAATAATTAAAGGAA
TTACCCGTTAATGTTGATTGGAGATAAAAAGGAGTTGTTACCCCAGTTAAAGGTATTATT
TTATTTACAATTATATAATTCATTTAAAGTTAAATCATATTTTTTTAAACTAATAGATTA
AGGTCACTGCGGTTCTTGTTGGGCTTTTGCTTCAACTGCTACTATTGAATCCTATGCAGC
CATTAACTCTGGTTAATTGAAAACTTTATCTACTCAATAACTCGTAAGTTGTGTTCCTAA
CCCTTACTAATGTGGTGGTACTGGTGGTTGCAATGGTGCTATTTCCGAATTAGCATTTAA
CTATGTCTAATTATACGGTTTAACCTCTGAATTCAAATATCCTTATCAAAGTTATGTATC
TGGTGTTACTGGTAACTGTACATTCGATTCAACTTAATAAACCCCTGAAGTAGCTTTAGA
TGGTTATGTCAAATTATAGGCTAACGACTACGATGCTTTACTTTATGCTCTTGCCAATAT
TGGTCCTTTGGCTGTTGCTGTAGATGCTAGTCAATGGCGTAATTACCAATCTGGTGTCTT
CAACGGATGCAGTTACACAGACAACATTGATGTAAACCACGTTGTAGTCCTTGTTGGTTA
CGGTACTGATCCTGAATTAGGTGACTATTGGTTGATTAGAAACTCATGGGGTACCAAATT
CGGTGAAAATGGTTATATCAGATTAGCTAGAGAATCTAAGGTTACTTGTGGTACTGACTA
TACTCCTTTAGATGGATAAGCTTGTGCTGGCCAAAATGTCCCTACTAAGGTTTGTGGTTA
ATGTGGTGTTGCTTATGATGCCGCTTATCCTACAAATGTTAGAGTAATTGGTTGA


>TTHERM_00558010(protein)
MNKLIILAIVLGLTVSQTYNSNLKQYTFDQYIQDFNKGYQYGSSEYFMRKAIFEQKLAEI
IAFNEQTNQSYKKGVNRFTDLTDSEFKQNSLGYSKNMSNVRAFRNLSVKNLEVTEQQLKE
LPVNVDWRQKGVVTPVKDQGHCGSCWAFASTATIESYAAINSGQLKTLSTQQLVSCVPNP
YQCGGTGGCNGAISELAFNYVQLYGLTSEFKYPYQSYVSGVTGNCTFDSTQQTPEVALDG
YVKLQANDYDALLYALANIGPLAVAVDASQWRNYQSGVFNGCSYTDNIDVNHVVVLVGYG
TDPELGDYWLIRNSWGTKFGENGYIRLARESKVTCGTDYTPLDGQACAGQNVPTKVCGQC
GVAYDAAYPTNVRVIG