Identifiers and Description

Gene Model Identifier

TTHERM_00558100

Standard Name

AMT3 (Adenine MethylTransferase (AMT) 3 targeting position N-six of Adenine)

Aliases

PreTt07908 | 73.m00152 | 3735.m00046 | MTA5

Description

MT-a70 family protein; MT-A70 RNA methyltransferase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14374.1 9.997093137033517e-262
Description: MT-A70 family protein (758 aa)
SGD YGL192W 9.997975313387782e-28
Description: IME4 Probable mRNA N6-adenosine methyltransferase required for entry into meiosis; transcribed in diploid cells; haploids repress IME4 transcription via production of antisense IME4 transcripts; antisense transcription is repressed in diploids
Oxytricha Contig17486.0.g100 1.0000422327488734e-24
Description: MT-A70
Stentor Coeruleus SteCoe_23497 0.0000000000018795288165390832
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:31722409: Wang Y, Sheng Y, Liu Y, Zhang W, Cheng T, Duan L, Pan B, Qiao Y, Liu Y, Gao S (2019) A distinct class of eukaryotic MT-A70 methyltransferases maintain symmetric DNA N6-adenine methylation at the ApT dinucleotides as an epigenetic mark associated with transcription. Nucleic acids research 47(22):11771-11789

Sequences

>TTHERM_00558100(coding)
ATGTAACCTCAACAGAATTAAAATTAGTAGCAATAATAATAGCAGCAATCATAGCAACAG
CAGTAATAAAATTAGCAACTGCCACAGCTTCAATAATCTATGTCTTCATAGCAGTAACAA
AATTAATAGTAAGAAAAATAAATTATAATAAAAAGAGGTACAACTTCAAAAAGAAACGAC
TACTGCTAGAATTTTGTTAATACTCATGAGCGTCCATAGAATTTTATTATGAATATCCGT
CCAGAAGAGCGTTTTATAGAATACCCAAAATTGCAAGATTTGATAAAATTTAAGGATGAT
TTAATTAAAAAGCGTAACCATCCTCCTGTATATTTAAAGGCTGATTTAAAATATTATGAT
TTGTCTAAGCTTGGTAAGTTTGATGTCATTATGATGGATCCACCTTGGAAGGAATATGAA
GAGAGAGTACAAGGTCTTCCCATATATAGCCAGTATCCTGAGAAATTTAATTCATGGGAT
CTAAATGAAATTGCTGCATTACCTATTGATGAAATTTCAGATAAACCTAGCTTTTTGTTT
TTATGGGTAGGCTCCGATCATTTAGATTAGGGAAGAGAACTGTTTAGAAAGTGGGGATAT
AAAAGATGTGAAGATATAGTTTGGGTAAAAACTAATAAAGATAAAACCAAAGAATATATA
GAATTACCTCATTCAAACCTTCTTGTGAGAGTTAAAGAACACTGTCTAGTAGGTTTACGT
GGAGATGTAAAAAGGGCTTCTGATTCTCATTTTATTCATGCAAATATAGATACTGATGTC
ATAGTAGCTGAGGAGCCTCCTCTTGGAAGTACTTAGAAACCTGCAGAAATATATGATATT
ATAGAGAGATTTTGCCTTGGAAGAAAGAGGTTAGAGTTATTTGGAGAAGTTCACAATGTC
AGATAAGGTTGGTTAACTATTGGAAAATTATTGGATGAAAGCAACTTTAATTAAGATGAG
TATAATAGTTGGTTTGATGGAGACAAAACTTATCCCTAAATATAAACCTATAGAGGTGGT
AGATATGTAGGAACAACACCTGATATAGAATAACTCAGGCCAAAATCTCCAACCAAAAAT
AATTAAATGAATTCAAACTAAAATATGTCTGGTTCTTAGGTTTCTGAATTTGACTTGGGA
ATACAATAGAAATAGCAAAAATTAAATCAGCAGTTTTGA


>TTHERM_00558100(gene)
ATGTAACCTCAACAGAATTAAAATTAGTAGCAATAATAATAGCAGCAATCATAGCAACAG
CAGTAATAAAATTAGCAACTGCCACAGCTTCAATAATCTATGTCTTCATAGCAGTAACAA
AATTAATAGTAAGAAAAATAAATTATAATAAAAAGAGGTACAACTTCAAAAAGAAACGAC
TACTGCTAGAATTTTGTTAATACTCATGAGCGTCCATAGAATTTTATTATGAATATCCGT
CCAGAAGAGCGTTTTATAGGTAATATTTTCAAAAATGAATTTATTTTTTAAGTGTTAAAT
TCAAATTCTAAAAAATTAATTGATTATTGAGCAGAATGAATGTCTATTGAAAACAAATTT
AAGAAATAAATGTGAATCAATCAAAATAAACTTTTCTTTTATTAAAATAGAATACCCAAA
ATTGCAAGATTTGATAAAATTTAAGGATGATTTAATTAAAAAGCGTAACCATCCTCCTGT
ATATTTAAAGGCTGATTTAAAATATTATGATTTGTCTAAGCTTGGTAAGTTTGATGTCAT
TATGATGGATCCACCTTGGAAGGAATATGAAGAGAGAGTACAAGGTCTTCCCATATATAG
CCAGTATCCTGAGAAATTTAATTCATGGGATCTAAATGAAATTGCTGCATTACCTATTGA
TGAAATTTCAGATAAACCTAGCTTTTTGTTTTTATGGGTAGGCTCCGATCATTTAGATTA
GGTATTTAAAAGAATTTATTAATGCATTTATTTACTTAGTAGACAGCTTAAACAATAAAA
ATATTAATAATTATGGGTGTTTTAATAATTAATTTTACATTTATTTTAATGTAGGGAAGA
GAACTGTTTAGAAAGTGGGGATATAAAAGATGTGAAGATATAGTTTGGGTAAAAACTAAT
AAAGATAAAACCAAAGAATATATAGAATTACCTCATTCAAACCTTCTTGTGAGAGTTAAA
GAACACTGTCTAGTAGGTTTACGTGGAGATGTAAAAAGGGCTTCTGATTCTCATTTTATT
CATGCAAATATAGATACTGATGTCATAGTAGCTGAGGAGCCTCCTCTTGGAAGTAAAAAA
TATAGCTTTTCCTTTAATCATTTTAAGATTTCATTTATATATTTTAATTGATATTTAAAA
AGGTACTTAGAAACCTGCAGAAATATATGATATTATAGAGAGATTTTGCCTTGGAAGAAA
GAGGTTAGAGTTATTTGGAGAAGTTCACAATGTCAGATAAGGTTGGTTAACTATTGGAAA
ATTATTGGATGAAAGCAACTTTAATTAAGATGAGTATAATAGTTGGTTTGATGGAGACAA
AACTTATCCCTAAATATAAACCTATAGAGGTGGTAGATATGTAGGAACAACACCTGATAT
AGAATAACTCAGGCCAAAATCTCCAACCAAAAATAATTAAATGAATTCAAACTAAAATAT
GTCTGGTTCTTAGGTTTCTGTAAATTTTTTTCATATTCATTCATAATATCAAAATAATTT
ATTTATTTTTTTAAGGAATTTGACTTGGGAATACAATAGAAATAGCAAAAATTAAATCAG
CAGTTTTGA


>TTHERM_00558100(protein)
MQPQQNQNQQQQQQQQSQQQQQQNQQLPQLQQSMSSQQQQNQQQEKQIIIKRGTTSKRND
YCQNFVNTHERPQNFIMNIRPEERFIEYPKLQDLIKFKDDLIKKRNHPPVYLKADLKYYD
LSKLGKFDVIMMDPPWKEYEERVQGLPIYSQYPEKFNSWDLNEIAALPIDEISDKPSFLF
LWVGSDHLDQGRELFRKWGYKRCEDIVWVKTNKDKTKEYIELPHSNLLVRVKEHCLVGLR
GDVKRASDSHFIHANIDTDVIVAEEPPLGSTQKPAEIYDIIERFCLGRKRLELFGEVHNV
RQGWLTIGKLLDESNFNQDEYNSWFDGDKTYPQIQTYRGGRYVGTTPDIEQLRPKSPTKN
NQMNSNQNMSGSQVSEFDLGIQQKQQKLNQQF