Identifiers and Description

Gene Model Identifier

TTHERM_00558440

Standard Name

SSA5 (HSP70a paralog)

Aliases

PreTt07941 | 73.m00185 | 3735.m00079

Description

SSA5 heat shock 70 kDa protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00012 ) DnaK family protein
  • ( PF00249 ) Myb-like DNA-binding domain
  • ( PF01968 ) hydantoinase/oxoprolinase
  • ( PF06723 ) MreB/Mbl protein
  • ( TIGR00071 ) tRNA pseudouridine synthase A
  • ( TIGR00904 ) cell shape determining protein, MreB/Mrl
  • ( TIGR01174 ) cell division protein FtsA
  • ( TIGR01784 ) conserved hypothetical protein
  • ( TIGR01991 ) Fe-S protein assembly chaperone HscA
  • ( TIGR02196 ) Glutaredoxin-like protein, YruB-family
  • ( TIGR02350 ) chaperone protein DnaK

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_994 0
Description: None
WormBase WBGene00002005 9.997093137033517e-262
Description: locus:hsp-1 Heat shock 70 kDa protein A status:Confirmed UniProt:P09446 protein_id:CAB02319.1
Tetrahymena borealis EI9_14410.1 9.997093137033517e-262
Description: dnaK protein (651 aa)
DictyBase DDB_G0269144 9.997093137033517e-262
Description: hspB on chromosome: 1 position 4410084 to 4412006
Oxytricha Contig18685.0.g30 9.997093137033517e-262
Description: Hsp70 protein
SGD YBL075C 9.997093137033517e-262
Description: SSA3 ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25586926: Fukuda Y, Akematsu T, Attiq R, Tada C, Nakai Y, Pearlman RE (2015) Role of the Cytosolic Heat Shock Protein 70 Ssa5 in the Ciliate Protozoan Tetrahymena thermophila. The Journal of eukaryotic microbiology 62(4):481-93

Sequences

>TTHERM_00558440(coding)
ATGTTTTTATTAAATATGACTGACTGTTCAAGTCAATTTAAATACTTGTTTGTTGTTTCA
TGTTAAAATTAAATTAAATATAATTAATTCTAAAACAAAATTAAAATAATAATTTATCAT
AGAAAATCTAATTAAAAAAACATGGCTAGTAGTAAGAAAGCAGAAGGAATTGCTATAGGT
ATCGATCTTGGTACCACATATTCTTGTGTCGGTATATTCTAAAACGAAAGAGTAGAAATT
ATTGCAAATGATTAAGGTAATAGAACTACTCCATCATATGTTGCTTTTACTGATACTGAA
AGACTAATTGGAGATGCTGCAAAGAACTAGGTAGCTAGAAATCCCATTAACACTGTCTTC
GATGCTAAGAGACTAATTGGTAGAAAGTACAATGATCCTGTTGTTTAAAAAGATATCAAG
CTATGGCCCTTTAAAGTAGAGAATGGCCCTGAAGATAAGCCTCTTATTGTTGTCAAATTC
AAAGGAGAGATAAAGAAATTTCATGCTGAAGAAATCTCATCAATGGTTCTTATTAAGATG
AAAGAAACAGCTGAAGCTTTCGTCTCAAAGCCAGTCAAGAATGCTGTCATTACTGTTCCT
GCTTACTTTAATGATTCATAAAGATAAGCAACCAAAGACGCTGGTATTATTGCTGGCCTC
AATGTACTCAGAATCATAAATGAGCCAACAGCTGCTGCTATTGCTTATGGCCTTGATCAA
AAGGGCAAAGGAGAGAAGAATATTTTAATCTTCGATCTTGGTGGTGGTACTTTTGATGTA
TCTCTCTTGACTATTGATAACGGCTTCTTTGAAGTGAAAGCCACTGCTGGTGATACCCAT
TTAGGAGGTGAAGACTTTGATAATAAGATGGTAGAATATTGTGCTGGTGAATTTTTGAAG
AAAAAAGGTATTGATATTAAAGGTAATCCTCGTGCTATGAGAAGACTAAGAACTTAGTGT
GAAAAAGCTAAGAGAATATTATCATCCTCTTCTTAAGCAACAATTGAAGTTGATGCCCTT
GCTGATTCAGAGGATTTCAATATCGTAATGTCACGTCCTAAATTTGAAGAACTGTGTCTT
CCTTACTTCTAATAGTGTGTTCCTCCTATTGAAAAAGTTATTAGGGACTCTGGATTATCA
AAGAACTAAATTGATGAAGTAATCCTTGTTGGTGGTTCTTCACGTATTCCTAAAGTCATT
TAGCTAGTTACTGAATTTTTTAATGGTAAAGAGCTTAATCGCTCTATAAATCCAGATGAG
GCTGTTGCTTATGGAGCTTCAGTTTAGGCTGCTATTCTCACAGGTTAAGGCTCTTAATCT
ATTTAAGATGTAATATTAGTTGATGTTGCTCCTCTTTCGCTTGGTATTGAGACTTCAGGT
GAAATAATGACAGTCCTAATTCCTAGAAATACTACTATTCCTATAAAAAAATCACAAATA
TTTACTACCTACGCTGATAACTAGCCTGGTGTATTAATTCAAGTTTTTGAAGGTGAAAGA
CCAATGACAAAAGACAATCATTTACTTGGAAAATTTGGATTAGAAGGAATTGCCCCTGCT
CCAAGAGGAGTCCCTCAAATCGAAGTATCGTTTGACATTGATGAGAACGGTATATTAAAT
GTCTCAGCTGTAGACAAAGCCACAAACAAATCTAATAAAATTACAATTACCAATTAAAAA
GGTAGATTCTCTCAAAGCGAGATAGAAAAGTTAGTAAAAGAAGCAGAGAAATACAAAGAC
GAAGATGAGAGGTAAAAGAAGAAAATAGAAGCCAAGAATTCATTTGAAAACTACATTTAC
CATGTTAGGAATAGTATGAAAGATGAAAAACTTAAAGACATATTCACATCTGATGAAAAG
GATAAACTAAATAATTTGATCGAAAAGAGCTAATCGTGGTTGGAAACTCATCATGGTGAG
AACCCTGATGACTATGAATCAAAACAAAAAGAGATTGAAAATGTATTTAATCCAATTATG
ATGAGAGTTTACTAACAAACAGGTGCTCAGCCCTAAGATAATTCAGAAGGTAGCAGAAGA
AATCAATACTAGAATAGCAGCACTGCTAATGCTGATGAAGTTGATTGA


>TTHERM_00558440(gene)
ATGTTTTTATTAAATATGACTGACTGTTCAAGTCAATTTAAATACTTGTTTGTTGTTTCA
TGTTAAAATTAAATTAAATATAATTAATTCTAAAACAAAATTAAAATAATAATTTATCAT
AGAAAATCTAATTAAAAAAACATGGCTAGTAGTAAGAAAGCAGAAGGAATTGCTATAGGT
ATCGATCTTGGTACCACATATTCTTGTGTCGGTATATTCTAAAACGAAAGAGTAGAAATT
ATTGCAAATGATTAAGGTAATAGAACTACTCCATCATATGTTGCTTTTACTGATACTGAA
AGACTAATTGGAGATGCTGCAAAGAACTAGGTAGCTAGAAATCCCATTAACACTGTCTTC
GATGCTAAGAGACTAATTGGTAGAAAGTACAATGATCCTGTTGTTTAAAAAGATATCAAG
CTATGGCCCTTTAAAGTAGAGAATGGCCCTGAAGATAAGCCTCTTATTGTTGTCAAATTC
AAAGGAGAGATAAAGAAATTTCATGCTGAAGAAATCTCATCAATGGTTCTTATTAAGATG
AAAGAAACAGCTGAAGCTTTCGTCTCAAAGCCAGTCAAGAATGCTGTCATTACTGTTCCT
GCTTACTTTAATGATTCATAAAGATAAGCAACCAAAGACGCTGGTATTATTGCTGGCCTC
AATGTACTCAGAATCATAAATGAGCCAACAGCTGCTGCTATTGCTTATGGCCTTGATCAA
AAGGGCAAAGGAGAGAAGAATATTTTAATCTTCGATCTTGGTGGTGGTACTTTTGATGTA
TCTCTCTTGACTATTGATAACGGCTTCTTTGAAGTGAAAGCCACTGCTGGTGATACCCAT
TTAGGAGGTGAAGACTTTGATAATAAGATGGTAGAATATTGTGCTGGTGAATTTTTGAAG
AAAAAAGGTATTGATATTAAAGGTAATCCTCGTGCTATGAGAAGACTAAGAACTTAGTGT
GAAAAAGCTAAGAGAATATTATCATCCTCTTCTTAAGCAACAATTGAAGTTGATGCCCTT
GCTGATTCAGAGGATTTCAATATCGTAATGTCACGTCCTAAATTTGAAGAACTGTGTCTT
CCTTACTTCTAATAGTGTGTTCCTCCTATTGAAAAAGTTATTAGGGACTCTGGATTATCA
AAGAACTAAATTGATGAAGTAATCCTTGTTGGTGGTTCTTCACGTATTCCTAAAGTCATT
TAGCTAGTTACTGAATTTTTTAATGGTAAAGAGCTTAATCGCTCTATAAATCCAGATGAG
GCTGTTGCTTATGGAGCTTCAGTTTAGGCTGCTATTCTCACAGGTTAAGGCTCTTAATCT
ATTTAAGATGTAATATTAGTTGATGTTGCTCCTCTTTCGCTTGGTATTGAGACTTCAGGT
GAAATAATGACAGTCCTAATTCCTAGAAATACTACTATTCCTATAAAAAAATCACAAATA
TTTACTACCTACGCTGATAACTAGCCTGGTGTATTAATTCAAGTTTTTGAAGGTGAAAGA
CCAATGACAAAAGACAATCATTTACTTGGAAAATTTGGATTAGAAGGAATTGCCCCTGCT
CCAAGAGGAGTCCCTCAAATCGAAGTATCGTTTGACATTGATGAGAACGGTATATTAAAT
GTCTCAGCTGTAGACAAAGCCACAAACAAATCTAATAAAATTACAATTACCAATTAAAAA
GGTAGATTCTCTCAAAGCGAGATAGAAAAGTTAGTAAAAGAAGCAGAGAAATACAAAGAC
GAAGATGAGAGGTAAAAGAAGAAAATAGAAGCCAAGAATTCATTTGAAAACTACATTTAC
CATGTTAGGAATAGTATGAAAGATGAAAAACTTAAAGACATATTCACATCTGATGAAAAG
GATAAACTAAATAATTTGATCGAAAAGAGCTAATCGTGGTTGGAAACTCATCATGGTGAG
AACCCTGATGACTATGAATCAAAACAAAAAGAGATTGAAAATGTATTTAATCCAATTATG
ATGAGAGTTTACTAACAAACAGGTGCTCAGCCCTAAGATAATTCAGAAGGTAGCAGAAGA
AATCAATACTAGAATAGCAGCACTGCTAATGCTGATGAAGTTGATTGA


>TTHERM_00558440(protein)
MFLLNMTDCSSQFKYLFVVSCQNQIKYNQFQNKIKIIIYHRKSNQKNMASSKKAEGIAIG
IDLGTTYSCVGIFQNERVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVARNPINTVF
DAKRLIGRKYNDPVVQKDIKLWPFKVENGPEDKPLIVVKFKGEIKKFHAEEISSMVLIKM
KETAEAFVSKPVKNAVITVPAYFNDSQRQATKDAGIIAGLNVLRIINEPTAAAIAYGLDQ
KGKGEKNILIFDLGGGTFDVSLLTIDNGFFEVKATAGDTHLGGEDFDNKMVEYCAGEFLK
KKGIDIKGNPRAMRRLRTQCEKAKRILSSSSQATIEVDALADSEDFNIVMSRPKFEELCL
PYFQQCVPPIEKVIRDSGLSKNQIDEVILVGGSSRIPKVIQLVTEFFNGKELNRSINPDE
AVAYGASVQAAILTGQGSQSIQDVILVDVAPLSLGIETSGEIMTVLIPRNTTIPIKKSQI
FTTYADNQPGVLIQVFEGERPMTKDNHLLGKFGLEGIAPAPRGVPQIEVSFDIDENGILN
VSAVDKATNKSNKITITNQKGRFSQSEIEKLVKEAEKYKDEDERQKKKIEAKNSFENYIY
HVRNSMKDEKLKDIFTSDEKDKLNNLIEKSQSWLETHHGENPDDYESKQKEIENVFNPIM
MRVYQQTGAQPQDNSEGSRRNQYQNSSTANADEVD