Identifiers and Description

Gene Model Identifier

TTHERM_00560000

Standard Name

CRS1 (Cysteinyl-tRNA Synthetase 1)

Aliases

PreTt27861 | 74.m00138 | 3720.m00029

Description

CRS1 cysteinyl-tRNA synthetase protein; Cysteinyl-tRNA synthetase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16175.1 9.997093137033517e-262
Description: cysteinyl-tRNA synthetase (724 aa)
Oxytricha Contig16632.0.g72 7.003368684633018e-175
Description: tRNA synthetases class I (C) catalytic domain
DictyBase DDB_G0287159 9.998596099208102e-158
Description: cysS on chromosome: 4 position 5412959 to 5415025
SGD YNL247W 1.0004559842325763e-117
Description: YNL247W Cysteinyl-tRNA synthetase; may interact with ribosomes, based on co-purification experiments
WormBase WBGene00000800 4.997537656037722e-111
Description: locus:cars-1 status:Partially_confirmed UniProt:Q965I6 protein_id:CCD70916.1
Stentor Coeruleus SteCoe_17823 1.314164668364901e-67
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00560000(coding)
ATGATTAAATAGATTACTAATCTAACAAAAACATTAAAAAAACGATTTTTGCAAGTGCCA
AAATATCCTTTTGGAAATAGCTGCTGCAACAAGAATTTATAAATAGCGAATCTCTTCTCT
ACTAATTAAAAAATGACAACTGAGGTAAAAAAAGACCCCTATCAATTATGGCAACTCCCT
GTTAAAGATGAAACCAAGTATTTAACAGGTCTTAAAGTTAAAAACACCTTAAATCCTTAG
AATTTAGTTGAATTCGTCCCTCACAAAGGCAAATAAGTTAGATTCTACAACTGTGGCCCT
ACAGTTTATGATTCTTCACACATTGGTCATGCCAGAACTTACATTTCTGCAGATATTATC
AAAAGAATTATGGTTAAGTACTTTGGCTATGATGTTTTCCACTGTATGAATATTACTGAC
ATAGATGACAAGATCATTAAAAAGTCAAATGAAAGTGGTGAAGAATTTACTGCCTTTGCC
AGAAAATGGGAAATGGATTACTGGTAAGACATGGAAACATTAAATGTTGATAAGCCTGAT
GTCATAGTCAGAGTTAGCGAATATGTACCAGAAATTATTTCTTACATTGAAAAAATTATT
GAAAATGGCTACGCTTATGTCGCTAATGGCTCCGTTTACTTCAATGTTGATAAATTCCAC
GAGTCTCCAACTCATTGCTACTCTAAACTCGAACCTCAAAGTGTTAATGATGCTTAAAAG
CTAGACGAAGGTGAAGGTGCTCTTGGCAAAAAAGATGAAAAGGAAAAAAGATCTCCTAGA
GACTTTGCTTTGTGGAAAGCAAGCAAACCTGGTGAGCCCTTCTGGGATAGTCCTTGGGGC
TAAGGTCGTCCTGGATGGCACATTGAATGTTCAACTATGGCCTCCGAAATTCTTGGATAT
CCAGTCGATATCCATATGGGAGGAGAAGACTTGAAATTCCCTCACCACGATAACGAATTG
GCTTAGAGTGAAGCCTTTTATAATAAATAAGATTGCTAAAATCAATGGGTTAACTACTTC
ATGCATACAGGCCATTTGCACATTGATGGATTAAAAATGTCAAAGAGTTTAAAAAATTTC
ATTACCATTAAGCATTTATCCAGCCAACACAGCTAGCGCGTTTTAAGACTTCTCTTTATG
AAATAAACATATGACTCTACAATGGATTACACCACTGATTCAATACATGAAGCTAAAACA
AAAGATAAAAAGTATTCAGAATTTTATCTTACAATGAACGCCATACTTCTTTAATCAGAA
ATCAATGTCCCATAGAAGTGGGGTCCTAGAGAATTTGAATTAAGAGACTTGTTTGTTGAA
AAGCAAGATAACATCCACAGGGCATTCTAAAAAAATTTCAATGTCCCTGAAGCACTTAAA
GAGCTTGACGAAATCATCACTGCTGTCAATACTTACATTAAGGAAAAGCCTATCATTCAT
CTTCTCATCAGAAGTATTTTCAACTACGTTAAGCATATTTTCAATTGCTTAGGTTTAATT
TATGAAAAGCAACAAGCTTAAGCTAAGGATGACACCTTCATTCGCACTGTTGGATTGATT
AGCAGTCTCAGAGATGAGATCAGAGGTGCAAACAAAGATTTGCAAGTTATCAACAAGGCA
GCTATTAATGCTAAGTCTTCTCTTGGTGAAATAACCTTAAAACTAGAACCAAATGCTAGT
GAAAGTGCTGTTTAGATTGCCACAGACTACATAACTTAAGTATTAAAATGTGTTGAAGAT
AACTAACTTTAACAGATTTATAAGGCTTCAGATGAAATCAGAGATGAAAAACTGATTTAG
ATTGGTATCCGTATTGATGATGGTAAACCTGGTGAGCCCAGTTTATGGAAAATCGATGAT
AAAGAAACTTTGCTAAAAGAGAAAGAAGAGAAAATACTCAAAGAAAAATAAAAAGAAGAA
GAAAAGCGCAAAAAAGAAGAAGAAAAATTGAAAGCTATGAGTGTGAATCCAGCAGAAATG
TTTAAAAATGATCCTAACTATAGCAAGTACCAATTTGATGAAAGAGGTATTCCTAGTCAC
GATGAAAAGGGCACTCCTCTTAAAGAAAAAGCTATTTAATCTTTTGTTAAAAAATACGAT
GCACAAAAGAAGCTCTATGAACAATACCTTGAAAAAACATCAAAAAAGTGA


>TTHERM_00560000(gene)
ATGATTAAATAGATTACTAATCTAACAAAAACATTAAAAAAACGATTTTTGCAAGTGCCA
AGTAATTTATTATTATTATTTCAACTCAATCAGGGATTTGGATGTGACATAACCCTCTTT
TTCAAGCCTTTTGCAGATTGAATTTTTGACATTTTAGTATTAGGAGTTAAGAAAGTCAAT
CAAACACTTAGACAAAATACTTGCTAATTAATTAGCAATTTTTTGCTTTTATTAAAAAGG
TTATAGTCTCCAAACAAATCCTCACTAAAAATTTTATTAACTTAAGATAGATCTTAATTA
TTTTATATAAAATTAATTAAAAGAATATCCTTTTGGAAATAGCTGCTGCAACAAGAATTT
ATAAATAGCGAATCTCTTCTCTACTAATTAAAAAATGACAACTGAGGTAAAAAAAGACCC
CTATCAATTATGGCAACTCCCTGTTAAAGATGAAACCAAGTATTTAACAGGTCTTAAAGT
TAAAAACACCTTAAATCCTTAGAATTTAGTAAATTTTTGACTTTTAAGTTTAATAGCTTT
TTTGCATAATAATTTTCATATTTGAATAATTTCTAAATTTTGTTATTTAAAGGTTGAATT
CGTCCCTCACAAAGGCAAATAAGTTAGATTCTACAACTGTGGCCCTACAGTAAAGCATTT
TCTAAGTTTACTAAGATTTTTAAACATTTTTTTCCATTATAATTTTAAATTTTGCAGCTT
TTGTTTACTGCGCTGCATAAATTAATTGGATAGCGAAAAAGGAAAAAGCACAAATAAAAA
TAAAATAAATTTAGATAGGTCTTTTAATTAAATGAAATATTATATAGGTTTATGATTCTT
CACACATTGGTCATGCCAGAACTTACATTTCTGCAGATATTATCAAAAGAATTATGGTTA
AGTACTTTGGCTATGATGTTTTCCACTGTATGAATATTACTGACATAGATGACAAGATCA
TTAAAAAGTCAAATGAAAGTGGTGAAGAATTTACTGCCTTTGCCAGAAAATGGGAAATGG
ATTACTGGTAAGACATGGAAACATTAAATGTTGATAAGGTAATCAATCATTTTTATATAA
TTAATTTAAATAAGTTTAGCAATAAGCATTATTAAGCCTTTTTATTTAAACTTAATAGCC
TGATGTCATAGTCAGAGTTAGCGAATATGTACCAGAAATTATTTCTTACATTGAAAAAAT
TATTGAAAATGGCTACGCTTATGTCGCTAATGGCTCCGTTTACTTCAATGTTGATAAATT
CCACGAGTCTCCAACTCATTGCTACTCTAAACTCGAACCTCAAAGTGTTAATGATGCTTA
AAAGCTAGACGAAGGTGAAGGTGCTCTTGGCAAAAAAGATGAAAAGGAAAAAAGATCTCC
TAGAGACTTTGCTTTGTGGTAAGAAATTAAATATGATAAACATACATACATATAAACAAA
CAAATAGTTTTTATTATCATTTTGCATTTCAAAAAATAAAATCTTGTTAATTTAGAAGAT
TATTTAAAGGTTATTTAAATTAATTATTAATTCAACAGGAAAGCAAGCAAACCTGGTGAG
CCCTTCTGGGATAGTCCTTGGGGCTAAGGTCGTCCTGGATGGCACATTGAATGTTCAACT
ATGGCCTCCGAAATTCTTGGATATCCAGTCGATATCCATATGGGAGGAGAAGACTTGAAA
TTCCCTCACCACGATAACGAATTGGCTTAGAGTGAAGCCTTTTATAATAAATAAGATTGC
TAAAATCAATGGGTTAACTACTTCATGCATACAGGCCATTTGCACATTGATGGATTAAAA
ATGTCAAAGAGTTTAAAAAATTTCATTACCATTAAGCATTTATCCAGCCAACACAGCTAG
CGCGTTTTAAGACTTCTCTTTATGAAATAAACATATGACTCTACAATGGATTACACCACT
GATTCAATACATGAAGCTAAAACAAAAGATAAAAAGTATTCAGAATTTTATCTTACAATG
AACGCCATACTTCTTTAATCAGAAATCAATGTCCCATAGAAGTGGGGTCCTAGAGAATTT
GAATTAAGAGACTTGTTTGTTGAAAAGCAAGATAACATCCACAGGGCATTCTAAAAAAAT
TTCAATGTCCCTGAAGCACTTAAAGAGCTTGACGAAATCATCACTGCTGTCAATACTTAC
ATTAAGGAAAAGCCTATCATTCATCTTCTCATCAGAAGTATTTTCAACTACGTTAAGCAT
ATTTTCAATTGCTTAGGTTTAATTTATGAAAAGGTAATTAATTTTGATTCATTGTTTCGT
TTGATAGAATAATTTTTATGGAAGGAAAGAGAAGTTTTTAATTAAATAAAATCAATTAAT
TTCTCAATTTCTAGAGTTTTATTTTAATATTTTACCACAAATTAAAAGAAATGAATGAAA
AGTGCTAAATAATAAATTTTCGATTTGGAGTTAATTATATTTATTGTCTGTACTTTTTAG
CATCAATCTTTTAGTTTTTTTTTATTATATAATTTTTATTTTGTCTGTCTAAGACATTTT
TTATCATTTACTTTATTTTATTACAGCAACAAGCTTAAGCTAAGGATGACACCTTCATTC
GCACTGTTGGATTGATTAGCAGTCTCAGAGATGAGATCAGAGGTGCAAACAAAGATTTGC
AAGTTATCAACAAGGCAGCTATTAATGCTAAGTCTTCTCTTGGTGAAATAACCTTAAAAC
TAGAACCAAATGCTAGTGAAAGTGCTGTTTAGATTGCCACAGACTACATAACTTAAGTAT
TAAAATGTGTTGAAGATAACTAACTTTAACAGATTTATAAGGCTTCAGATGAAATCAGAG
ATGAAAAACTGATTTAGATTGGTATCCGTATTGATGATGGTAAACCTGGTGAGCCCAGTT
TATGGAAAATCGATGATAAAGAAACTTTGCTAAAAGAGAAAGAAGAGAAAATACTCAAAG
AAAAATAAAAAGAAGAAGAAAAGCGCAAAAAAGAAGAAGAAAAATTGAAAGCTATGAGTG
TGAATCCAGCAGAAATGTTTAAAAATGATCCTAACTATAGCAAGTACCAATTTGATGAAA
GAGGTATTCCTAGTCACGATGAAAAGGGCACTCCTCTTAAAGAAAAAGCTATTTAATCTT
TTGTTAAAAAATACGATGCACAAAAGAAGCTCTATGAACAATACCTTGAAAAAACATCAA
AAAAGTGA


>TTHERM_00560000(protein)
MIKQITNLTKTLKKRFLQVPKYPFGNSCCNKNLQIANLFSTNQKMTTEVKKDPYQLWQLP
VKDETKYLTGLKVKNTLNPQNLVEFVPHKGKQVRFYNCGPTVYDSSHIGHARTYISADII
KRIMVKYFGYDVFHCMNITDIDDKIIKKSNESGEEFTAFARKWEMDYWQDMETLNVDKPD
VIVRVSEYVPEIISYIEKIIENGYAYVANGSVYFNVDKFHESPTHCYSKLEPQSVNDAQK
LDEGEGALGKKDEKEKRSPRDFALWKASKPGEPFWDSPWGQGRPGWHIECSTMASEILGY
PVDIHMGGEDLKFPHHDNELAQSEAFYNKQDCQNQWVNYFMHTGHLHIDGLKMSKSLKNF
ITIKHLSSQHSQRVLRLLFMKQTYDSTMDYTTDSIHEAKTKDKKYSEFYLTMNAILLQSE
INVPQKWGPREFELRDLFVEKQDNIHRAFQKNFNVPEALKELDEIITAVNTYIKEKPIIH
LLIRSIFNYVKHIFNCLGLIYEKQQAQAKDDTFIRTVGLISSLRDEIRGANKDLQVINKA
AINAKSSLGEITLKLEPNASESAVQIATDYITQVLKCVEDNQLQQIYKASDEIRDEKLIQ
IGIRIDDGKPGEPSLWKIDDKETLLKEKEEKILKEKQKEEEKRKKEEEKLKAMSVNPAEM
FKNDPNYSKYQFDERGIPSHDEKGTPLKEKAIQSFVKKYDAQKKLYEQYLEKTSKK