Identifiers and Description

Gene Model Identifier

TTHERM_00561680

Standard Name

RPL35 (Ribosomal Protein of the Large subunit #35)

Aliases

PreTt27928 | 74.m00205 | 3720.m00095

Description

RPL35 ribosomal protein L35; Homolog of Yeast RPL35- Bacterial RPL29

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16114.1 3.000298514542485e-73
Description: 50S ribosomal protein L29 (125 aa)
Oxytricha Contig1454.1.g21 7.000402845995459e-29
Description: Ribosomal L29 protein
DictyBase DDB_G0288349 2.000470901975128e-28
Description: rpl35 on chromosome: 5 position 1418812 to 1419513
SGD YDL191W 3.999672240330216e-26
Description: RPL35A Protein component of the large (60S) ribosomal subunit, identical to Rpl35Bp and has similarity to rat L35 ribosomal protein
WormBase WBGene00004449 4.998021988471165e-24
Description: locus:rpl-35 60S ribosomal protein L35 status:Confirmed UniProt:P34662 protein_id:CCD62549.1
Stentor Coeruleus SteCoe_17844 0.0000000000002543665647376923
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00561680(coding)
ATGGATAAGTCTGTCAGAGTTTTCAAGCTTAGAACCTAAACTGAAGAATAGCTCGTCGGT
GAACTCGGCAAGCTCTAAACTGAACTTTCCCAACTCAGAATTGCCAAGATTGCTGGTGGT
ACTGCTAACAAGCTCGGCAGAATTGGCATCGTCAGAAAGGCTATTGCTAAATACTTGACC
ATTATCAACGAAAAGAGAAGACAAGCTGTCAAGGACTAATTCAAGGGTAAGTCTTTGAAG
CCTTTGGACATTAGAGTCAAGAAGACTAGAGCTATTAGAAGAAAACTCACCAAGAAGCAA
AGAGAAGCTGTCCTCGTCAAGACCCAAAAGAAATTAAACAACTTCGGTCTTAGAAAGTTC
GCCCTCAAGGCTTGA


>TTHERM_00561680(gene)
ATGGATAAGTCTGTCAGAGTTTTCAAGCTTAGAACCTAAACTGAAGAATAGCTCGTCGGT
GAACTCGGCAAGCTCTAAACTGAACTTTCCCAACTCAGAATTGCCAAGATTGCTGGTGGT
ACTGCTAACAAGCTCGGCAGAATTGGCGTATGATACCTTATTAATTCAAATATCTCTCAT
TATTTCTTTTTATCAATTTAATCCATTTTTCGCATTTCATTTTTAGGTTATGCAAATCGC
TTTTTTGTCAAATTTTTTACAATTTTTCAATATTAAAACCAAAATAACATTTTACTTAAT
ATCATTTTTGACAAAGTATTTTCGTAATTTTTGGATTTGATAAATGCTAAAACTTAAAAT
TTGACTTAAATATTGAGATTGTTTGTTTGTTTGTTTATTTAAGATGATCAAGTAATAAAT
AATAACTACTTCAGATTAACAGCTACTAACTTAGTCTAGCATGAACAAAACGTTTTAGGC
CAATGTGAAAAAATAAGATTTAATTCTAAGTAAAGTATTAACTAACACTTACAAGCAACT
AATTTTAGGAAAATGATGATACACTATGAAATCAAAATCGCATTTTCAAAGCTGTTTTAC
CAAAGAAAGTGATTGTTATTAAATAAATAAAGAAGCTTTCAAGAAGCCCCTATTAATATG
ATAGCAGAACCATATATAAAATCAAAATTAATTTAGCCCCTCAATAAAACAAAGAAAGAT
AAGTAAATAATCAAATTACTGACAAATAAGCTATGTCTTAGCTCAGTATGGCAATAAATT
TAGTAGGAAGCGTTAAAGATATTCAGAAATAGCTAAAATGCGTTAATAAACACATATTTG
TTTGAAATGGATGGGACTTAACTTTAAATGTAATTAAGTGTTAAAAATAGGCAGGCAAAT
AAAAATATAATATTAGTGAAACATATAATTGAATAAAGAGATAATTAACTAACTAACATT
AGTAAGGCAGATATTCACCATTCTTAATTAACAGCAAAGCTCAAAAATAATGATTGCTTG
AATATAGATAGATTAAATAAATATAAACTTTTAAGATGAAACAATGTAATAATAATAATA
ATAATGTATTTAAGGATACTTTAAACTGGCAAATGATTTAAATTAACTATCGAAAATCTT
AATAGATAAACAAACATAAAAGATAAATTAATATTCTACTGACAAAGCAAAATTAAAAAA
TGAAATTTTTTGGATTAATTATCAAAGCATTTATTAATTAATTAAATAAAATACTTTGAA
AATGAGAGATATTTATTTATTTATTAATTTATTTATTTTAAAAATATAATATTAACAAGT
AATAATTAAAATTATTAATAAAATAAATAGATCGTCAGAAAGGCTATTGCTAAATACTTG
ACCATTATCAACGAAAAGAGAAGACAAGCTGTCAAGGACTAATTCAAGGGTAAGTCTTTG
AAGCCTTTGGACATTAGAGTCAAGAAGACTAGAGCTATTAGAAGAAAACTCACCAAGAAG
CAAAGAGAAGCTGTCCTCGTCAAGACCCAAAAGAAATTAAACAACTTCGGTCTTAGAAAG
TTCGCCCTCAAGGCTTGA


>TTHERM_00561680(protein)
MDKSVRVFKLRTQTEEQLVGELGKLQTELSQLRIAKIAGGTANKLGRIGIVRKAIAKYLT
IINEKRRQAVKDQFKGKSLKPLDIRVKKTRAIRRKLTKKQREAVLVKTQKKLNNFGLRKF
ALKA