Identifiers and Description

Gene Model Identifier

TTHERM_00561720

Standard Name

MRNN15 (Membrane Occupation and Recognition Nexus protein N-terminal)

Aliases

PreTt27932 | 74.m00209 | 3720.m00099

Description

radial spoke head-like protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16111.1 9.997093137033517e-262
Description: hypothetical protein (928 aa)
Oxytricha Contig21976.0.g73 1.9994050701445255e-104
Description: MORN repeat
Stentor Coeruleus SteCoe_16722 1.6458114310822737e-38
Description: None
WormBase WBGene00002179 2.000769134519826e-18
Description: locus:jph-1 status:Confirmed UniProt:Q22667 protein_id:CAA99924.2
DictyBase DDB_G0349488 0.000000000040005666873964816
Description: DDB_G0349488 on chromosome: 2 position 6912714 to 6914186

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00561720(coding)
ATGTAGATAGATTTAGAATAGGAATCTCAGTCTTTATAGGCTGATAATATAATTCTTCCT
TTAGAATATACAAAATTAATTATAGATGATTACGAGACCTAAGAACTTATTATCTAAGAT
AAGAAAAGCTAAATTTATGCTAAATCAATTAATGGGTAATCTGTGTTATATTTCAAAAAC
GGAGATACTTACTAGGGCGATATTTTTAAAGGAATCATGCATGGTAAAGGTGTTTTTAAG
TGGGAAAACGGAGCAAAATATGTCGGAACATTTGTTTATAATGAGATTTAAGGCGAAGGA
GAGTATTTTTGGCCTGATGGAAGCTATTATAAAGGCTAAGTTATGCATGGTAAAAGGCAT
GGCCATGGATATTATGAAACAGAGAATAAAAAAACTATTTATGAGGGAGAGTGGTTCGCT
GGAAAGCGTCAAGGAAAAGGAAAAATAGTTTTCTCATCAGGAGCAAGTTATGAAGGAGAA
TTTTTTAATGGTATAAAGCATGGAAAAGGAATATTTAAATATGCATCAGGAAATTATTAT
GAAGGCGAATATGTAAATGATAAAAAGGAAGGATATGGAGTCATGTATTGGCTTGATACA
TCAGAGAAGTACTTTGGAAACTGGTCAAATAATCTTTAAAATGGCTTTGGAGTTCATATT
TGGTTAGAAAATAAGGGTGAAAAAAAGATGTTCAGAAACAGGTATGAAGGCTAATGGTTA
GATGGTGAAAGACATGGGTATGGTGTATTTTATTATGCTAATGGGAGTAAATATGAAGGA
TAATGGGTTAAAAACTTGAAAGAAGGATTTGCAGTATTCACTGAAGATAACGGCAACATC
ATTTAAGGAACATTCAAAGGAGATAAATTAATTCAAAATATTTTAGATAAACCTCTACTC
AGTTTGAATTTTGATGAGTTGGATAAAACAGATTTAAACAACTCCAATTCCTAGACTTTC
TCTCCTCAAACAAGAACTAATAGCAAGAAAAACACAAGCATTAAGAAGGAGAGTTCACCT
CTTCCTAAAAAATCTATACTAGGTACTTCTATGAGTAAGCCATTAATTTAAATTTAATAG
AAATCTTAAAGCGTTTTGTAGACATCTTCAGCATCTATTAATAATATATTGTAAGATAAT
CAAAAACAATCGTCATCTTTCAAACCTGCTAATTAAACAACAAATGAAACAAACAAAGAT
GAAAAATAAAACTAAATTAATAAGTCGATTTTAGGATCTGAGGGTGCAAGTAATCTCCCA
ACAAAAAGGTCTAATGAAAATAACAAGGATTAAGTAAAGGATTCACAATAAGATACTAAA
AAGTAAACAAAAAAAGATTAGAAAAAAGATTAATAAAAAGAGGATGAATAAAAGCAGCTT
TAAGAAAATCCTTACAATACCCTGCTTGATTACAGTGACTTAGACATAAACTTTCAAGAT
GCCTAAGCAGTTCATAAAAATGTCAACACAGTTTTACTACGACACAATTCTAACTTGATA
TAGTGGTATAAAGATTGCTCTTAGAGATATGAGAGCACGTTAGGAGAAAAATCTTTCACT
ATGGATATGCAATAAATTTGGAAGTTTTTAAAAGAAATTAAAATATTTGGTGGTAGTGTT
ACATAATCTACAATTAATAGATTGTTTCATAGAGGTAGAAAGAATTATTACTCAATACAG
GCTAGTGAAAAAGAATTATTAACTGAGTTAGAGGCTATTAAATCTTTAGGCAGATTTATA
ACAGAAGAAGAAAGAAAAGATTTAAAATTGGTAGAATTCCTCTAAGCCTATAAAAAAAAG
ATTAAATATGAAAAAATATTGACACCAAATATTTTTGAATAAGACCCTAACCAAGAAACA
GAAGAAATATACTATACTAAAGTTATCAACATTCACGATATGTCATAGCCTATTTTGTAT
CGCCATTTTGTTGATGTTCTCGTCAGAGTAGCTTATTTAAGGTCGAAAATACCAGATCAA
TTACATCTTGAGTTAGAAAAAATTATTGAATAGCACATAAAACCATTTTTCGAAAATAAA
AAGAAAAGCATGAAAACTTCCTCTAAATTAAACGAAGATGAACTTCAAAGCTACTTCAAC
AAGGCTACTTTTATTAAACACAGTTGTATGGATAACTTACATAAAATTTTTGATAAAATA
AAAACTGTAAATAGATCTTCTAAGTTTGGTTATTCTGACGAAACTTGCCTTCTTTAAGGA
CTAATAAAAGTTTTAAAATCTAGTGAGATTATTAAAAACGATGCTGACTAAAACTTTCTT
TATTTCATTCTTGAGCAAGGATTCGATCCTAATCTAACCCTAGGCCAGATAGATTAGATG
ATTAAAGAAAGAGAAAAAGAGAGAGAGAAAGAACAATAAAAGGTAAATAATAAACGTGCC
TAAGTTAAAGCAAGCAATTAAAGAAAAAAAACTCCAGATTTTAAAAAGATGAAAGAGGAA
AAAATAAATATCTTAATCAACACAGAATTAATTTTTAGTGAGTTCATAAAGTTAATTCTA
GTTTACACCATTAAGCATATTAAAGATCTCCATACTAAAATAGATGATGATATCTTAGAA
AAGAAAGTCTCCTAAATGATCGAAAAAATAAATAAAAAAACAATAAATTATAATGATCCG
AGATTAAGCTAAACTACAACAAAGAAAATTTGGCCTACAAGTATTAAAGATTAATTAAAA
GTTGAACTTGCAAAGAATAGACTCAAAAAGGAAGAGTTAGAAAAAGAAAAAAAGAGGAAG
GAAGAAGAAAGAAAGAGAGAATAAAGAGAAAAAGCTTAAATGGAACTAAACGATTTTAAT
GCCCCTTCAGATATAGAAATTGATAGTGAAGATGACTATTGA


>TTHERM_00561720(gene)
ATGTAGATAGATTTAGAATAGGAATCTCAGTCTTTATAGGCTGATAATATAATTCTTCCT
TTAGAATATACAAAATTAATTATAGATGATTACGAGACCTAAGAACTTATTATCTAAGAT
AAGAAAAGCTAAGTACTTATTTAACGATCAATTCATTTTATTAGTTGACTGCATTTGATT
ATAACTACATTATATTAGCATTATAAAAATCAATATTTTATATACTAACATAAGATTTAT
GCTAAATCAATTAATGGGTAATCTGTGTTATATTTCAAAAACGGAGATACTTACTAGGGC
GATATTTTTAAAGGAATCATGCATGGTAAATTATCTTTCAATTATTATATCATTTTTATT
TATATGATAAATTTATTGCTAAAATTTATAATTAAATCATTTAAAAAACAAGGTAAAGGT
GTTTTTAAGTGGGAAAACGGAGCAAAATATGTCGGAACATTTGTTTATAATGAGATTTAA
GGCGAAGGAGAGTATTTTTGGCCTGATGGAAGCTATTATAAAGGCTAAGTTATGCATGGT
AAAAGGCATGGCCATGGATATTATGAAACAGAGAATAAAAAAACTATTTATGAGGGAGAG
TGGTTCGCTGGAAAGCGTCAAGGAAAAGGAAAAATAGTTTTCTCATCAGGGTATATATAC
TTCAAATAAACATTAATAATTTTGACTAATTTACTTCTTTAAATAAATAAATAAATAATT
TAGAGCAAGTTATGAAGGAGAATTTTTTAATGGTATAAAGCATGGAAAAGGAATATTTAA
ATATGCATCAGGAAATTATTATGAAGGCGAATATGTAAATGATAAAAAGGAAGGGTAATT
AATTTATTTATTTATTTGTTTATAATCAAATAAATCATTTTTAAAAGAAATGCAAATTTT
ATTTGGAGAAAATCAAAATTAAAAATTATAAAAGTGAAATAGTATTAATGCTTATTATAC
ATATGCTCATTATAAATTTAATAATATCAAATAAATATGATTTTTCTTTATTTGAAGATA
TGGAGTCATGTATTGGCTTGATACATCAGAGAAGTACTTTGGAAACTGGTCAAATAATCT
TTAAAATGGCTTTGGAGTTCATATTTGGTTAGAAAATAAGGGTGAAAAAAAGATGTTCAG
AAACAGGTGTCTATTTATCGATTTTTAATTGATTACTTTGAATTTCTTAAATTGATTTTA
ATTGTTAAATAGGTATGAAGGCTAATGGTTAGATGGTGAAAGACATGGGTATGGTGTATT
TTATTATGCTAATGGGAGTAAATATGAAGGATAATGGGTTAAAAACTTGAAAGAAGGATT
TGCAGTATTCACTGAAGATAACGGCAACATCATTTAAGGAACATTCAAAGGAGATAAATT
AATTCAAAATATTTTAGATAAACCTCTACTCAGTTTGAATTTTGATGAGTTGGATAAAAC
AGATTTAAACAACTCCAATTCCTAGACTTTCTCTCCTCAAACAAGAACTAGTAAAAAAAT
AATTAATCTATCTCACTTCAACTTACTTTGATTATTTTTTACTTTTTTAATTTAAAGAAA
TATCAAAAAACTCATTTCAACTTTCATTATTTTTTGTTTTTTAATTTCAAATAGATAGCA
AGAAAAACACAAGCATTAAGAAGGAGAGTTCACCTCTTCCTAAAAAATCTATACTAGGTA
CTTCTATGAGTAAGCCATTAATTTAAATTTAATAGAAATCTTAAAGCGTTTTGTAGACAT
CTTCAGCATCTATTAATAATATATTGTAAGATAATCAAAAACAATCGTCATCTTTCAAAC
CTGCTAATTAAACAACAAATGAAACAAACAAAGATGAAAAATAAAACTAAATTAATAAGT
CGATTTTAGGATCTGAGGGTGCAAGTAATCTCCCAACAAAAAGGTCTAATGAAAATAACA
AGGATTAAGTAAAGGATTCACAATAAGATACTAAAAAGTAAACAAAAAAAGATTAGAAAA
AAGATTAATAAAAAGAGGATGAATAAAAGCAGCTTTAAGAAAATCCTTACAATACCCTGC
TTGATTACAGTGACTTAGACATAAACTTTCAAGATGCCTAAGCAGTTCATAAAAATGTCA
ACACAGTTTTACTACGACACAATTCTAACTTGATATAGTGGTATAAAGATTGCTCTTAGA
GATATGAGAGCACGTTAGGTATAATTTAATTTTAATCGATTATGCTTGATATTTATTAAA
CAAACATTTTTAGGAGAAAAATCTTTCACTATGGATATGCAATAAATTTGGAAGTTTTTA
AAAGAAATTAAAATATTTGGTGGTAGTGTTACATAATCTACAATTAATAGATTGTTTCAT
AGAGGTAGAAAGAATTATTACTCAATACAGGCTAGTGAAAAAGAATTATTAACTGAGTTA
GAGGCTATTAAATCTTTAGGCAGATTTATAACAGAAGAAGAAAGAAAAGATTTAAAATTG
GTAGAATTCCTCTAAGCCTATAAAAAAAAGATTAAATATGAAAAAATATTGACACCAAAT
ATTTTTGAATAAGACCCTAACCAAGAAACAGAAGAAATATACTATACTAAAGTTATCAAC
ATTCACGATATGTCATAGCCTATTTTGTATCGCCATTTTGTTGATGTTCTCGTCAGAGTA
GCTTATTTAAGGTCGAAAATACCAGATCAATTACATCTTGAGTTAGAAAAAATTATTGAA
TAGCACATAAAACCATTTTTCGAAAATAAAAAGAAAAGCATGAAAACTTCCTCTAAATTA
AACGAAGATGAACTTCAAGTAATTAATTTGTTTTTATTTATTCTAGCTTAAATATTTTTA
GCACTGAAAATTCAGAAATAATCTATATTAATTTCAATTTCATTCATATTTTTAATAATA
TAAAGCATTCTTTTAAAATTTTTAAAGTATTTTTACAAATTTATTTAATTTATTTTATAA
TTTAAAGAGCTACTTCAACAAGGCTACTTTTATTAAACACAGTTGTATGGATAACTTACA
TAAAATTTTTGATAAAATAAAAACTGTAAATAGATCTTCTAAGTTTGGTTATTCTGACGA
AACTTGCCTTCTTTAAGGACTAATAAAAGTTTTAAAAGTAATAAAAACTAAAAAATGTGT
ATTTAATTTTAATTCTTTTTATCATAAATAAATAAATCTTAGTCTAGTGAGATTATTAAA
AACGATGCTGACTAAAACTTTCTTTATTTCATTCTTGAGCAAGGATTCGATCCTAATCTA
ACCCTAGGCCAGATAGATTAGATGATTAAAGAAAGAGAAAAAGAGAGAGAGAAAGAACAA
TAAAAGGTAAATAATAAACGTGCCTAAGTTAAAGCAAGCAATTAAAGAAAAAAAACTCCA
GATTTTAAAAAGATGAAAGAGGAAAAAATAAATATCTTAATCAACACAGAATTAATTTTT
AGTGAGTTCATAAAGTTAATTCTAGTTTACACCATTAAGCATGTAATTAATTATCAACTA
TTTATTTATAATCATATTAATAATTGCTATTTAAAAATAAAGATTAAAGATCTCCATACT
AAAATAGATGATGATATCTTAGAAAAGAAAGTCTCCTAAATGATCGAAAAAATAAATAAA
AAAACAATAAATTATAATGATCCGAGATTAAGCTAAACTACAACAAAGAAAATTTGGCCT
ACAAGTATTAAAGATTAATTGTAAATTTGTTTGTTTATTTATTTACTTACTTATTAAAAG
AGTTTAAAAAATTTAAAATCAAATAAATATTATAGAAAAGTTGAACTTGCAAAGAATAGA
CTCAAAAAGGAAGAGTTAGAAAAAGAAAAAAAGAGGAAGGAAGAAGAAAGAAAGAGAGAG
TATTTCAAAATTTAATAAAAATAAATTAAAACAAATTTTATTTTATTAATTTTTTTTTAT
TTTAATGTTAAATAGATAAAGAGAAAAAGCTTAAATGGAACTAAACGATTTTAATGCCCC
TTCAGATATAGAAATTGATAGTGAAGATGACTATTGA


>TTHERM_00561720(protein)
MQIDLEQESQSLQADNIILPLEYTKLIIDDYETQELIIQDKKSQIYAKSINGQSVLYFKN
GDTYQGDIFKGIMHGKGVFKWENGAKYVGTFVYNEIQGEGEYFWPDGSYYKGQVMHGKRH
GHGYYETENKKTIYEGEWFAGKRQGKGKIVFSSGASYEGEFFNGIKHGKGIFKYASGNYY
EGEYVNDKKEGYGVMYWLDTSEKYFGNWSNNLQNGFGVHIWLENKGEKKMFRNRYEGQWL
DGERHGYGVFYYANGSKYEGQWVKNLKEGFAVFTEDNGNIIQGTFKGDKLIQNILDKPLL
SLNFDELDKTDLNNSNSQTFSPQTRTNSKKNTSIKKESSPLPKKSILGTSMSKPLIQIQQ
KSQSVLQTSSASINNILQDNQKQSSSFKPANQTTNETNKDEKQNQINKSILGSEGASNLP
TKRSNENNKDQVKDSQQDTKKQTKKDQKKDQQKEDEQKQLQENPYNTLLDYSDLDINFQD
AQAVHKNVNTVLLRHNSNLIQWYKDCSQRYESTLGEKSFTMDMQQIWKFLKEIKIFGGSV
TQSTINRLFHRGRKNYYSIQASEKELLTELEAIKSLGRFITEEERKDLKLVEFLQAYKKK
IKYEKILTPNIFEQDPNQETEEIYYTKVINIHDMSQPILYRHFVDVLVRVAYLRSKIPDQ
LHLELEKIIEQHIKPFFENKKKSMKTSSKLNEDELQSYFNKATFIKHSCMDNLHKIFDKI
KTVNRSSKFGYSDETCLLQGLIKVLKSSEIIKNDADQNFLYFILEQGFDPNLTLGQIDQM
IKEREKEREKEQQKVNNKRAQVKASNQRKKTPDFKKMKEEKINILINTELIFSEFIKLIL
VYTIKHIKDLHTKIDDDILEKKVSQMIEKINKKTINYNDPRLSQTTTKKIWPTSIKDQLK
VELAKNRLKKEELEKEKKRKEEERKREQREKAQMELNDFNAPSDIEIDSEDDY