Identifiers and Description

Gene Model Identifier

TTHERM_00564190

Standard Name

Aliases

PreTt08957 | 75.m00155 | 3721.m00037 | TPPT1

Description

tyrosine phosphatase; Protein-tyrosine phosphatase containing protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF00102 ) Protein-tyrosine phosphatase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14569.1 1.999126889527329e-167
Description: protein-tyrosine phosphatase containing protein (327 aa)
Oxytricha Contig11522.0.g89 1.0002546821282671e-50
Description: Protein-tyrosine phosphatase
DictyBase DDB_G0273097 1.000159011384939e-43
Description: ptpA1-1 on chromosome: 2 position 2586710 to 2588480
WormBase WBGene00004213 5.998886722426197e-42
Description: locus:ptp-1 Tyrosine-protein phosphatase 1 status:Partially_confirmed UniProt:P28191 protein_id:CAB54194.1
Stentor Coeruleus SteCoe_20825 1.7587922024243116e-25
Description: None
SGD YDL230W 1.9999391735788327e-19
Description: PTP1 Phosphotyrosine-specific protein phosphatase that dephosphorylates a broad range of substrates in vivo, including Fpr3p; localized to the cytoplasm and the mitochondria; proposed to be a negative regulator of filamentation

General Information

No. Gene Name(s) Paragraph Text
119 (no standard gene name) Tetrahymena thermophilia’s TPPT1 protein is homologous with proteins in the Y phosphatase family associated with the removal of phosphate groups from tyrosine residues. It contains 1 domain (E-value= 2.9E-67), which is a Y phosphatase domain. The closest homologs are found in Paramecium tetraurelia, Ichthyopthirius multifiliis, a freshwater fish disease, and Stentor coeruleus, a large ciliate. It is possible that this protein is involved in cell signaling pathways. Paragraph by: Margot Chisholm, Keck Science Center, Pitzer College.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00564190(coding)
ATGGACACAAAAAATAATTTGTAATAGGAAGAAGCCTTTTATGAAAAATTTGCAGTACCT
CCAGCTCCAATTAAAAAAGAAGAAATTGATTATTCATATACAGAAGAGTTAAAAGCAGAG
ACAAGAAAAATTAAGGATTTGCTGAATTTCAAAATGACTAATTAGTTTTAAGTATTGTAA
ATGATCACTCATACAAATAATCATCATAATAATAGAATCAAAGCAAATGAATTTTTAGAT
TATAATAGATATACTGATATTCTACCATATAAGCATTCAGTTGTTAAAATTAGCGGAAGT
ACCTAAGTTGATTAATACATAAATGCTAATTACATAAATAATCCCTTTAAAGATAAAGCT
TATATTGCTACTCAAGGACCTATTCCAAATACAATCTCTTCTTTTTGGAGAATGATATGG
GAATAAAAAACAAATTTGATTATTATGCTTTGCAAGGAATTCGTTAAATGTGATAAATAT
TGGCCAAGCCAAGGATAGATCTTATAGGAGGGAGATTTGCAAGTCCAATTTTTATCGTAG
TAAAAAAATGCATAATAGAATATTATTGAAAGACAATTCATACTCAAGTATAAAAATGAA
TAACGTTAAGTCTCTTAAGTGCATTGGGAAGGATGGCCAGATCATGGTGTTCCTGAAAGT
AGAGATTATGGAGTTTTAGAAAATTTAGTATAAAGGGTAGTAAATCAAATTGAATAGTCC
AAGATTCCTGTCGTGCATTGCAGTGCTGGAGTTGGTAGAACTGGTACATTGTTAGCCCTC
TCTAATATTTACATGACTTTGAAATATCATTAAGTTAAAAAAACTCCTATAGACTAAATA
GAATTAAACGTCTTAGATATAGTTAGAAGACTTAGAGAGTAAAGAATGATCATGGTATAA
ATGGATAACTAATTAAACTTAGTATATGAAATTACAAAAACTTTTATCAGAAAAATGTTC
AAATTTTGA


>TTHERM_00564190(gene)
ATGGACACAAAAAATAATTTGTAATAGGAAGAAGCCTTTTATGAAAAATTTGCAGTACCT
CCAGCTCCAATTAAAAAAGAAGAAATTGATTATTCATATACAGAAGAGTTAAAAGCAGAG
ACAAGAAAAATTAAGGATTTGCTGAATTTCAAAATGACTAATTAGTTTTAAGTAAATATT
TTAAGAATAGTTTAAATAAAATAAATTGTTAAAATAAAAATTTATTTCATCAAGGTATTG
TAAATGATCACTCATACAAATAATCATCATAATAATAGAATCAAAGCAAATGAATTTTTA
GATTATAATAGATATACTGATATTCTACCATGTAATTCTAAAAAAAATATAAAATGAAAA
TTAATCTAAAATTTGTTAAAATAGATAAGCATTCAGTTGTTAAAATTAGCGGAAGTACCT
AAGTTGATTAATACATAAATGCTAATTACATAAATGTATAATAATCAATTTTTTATTTTG
CGAATTATTGAAGTGTTTTGATTGTTTTTTATTTTTTGTTTAGAATCCCTTTAAAGATAA
AGCTTATATTGCTACTCAAGGACCTATTCCAAATACAATCTCTTCTTTTTGGAGAATGAT
ATGGGAATAAAAAACAAATTTGATTATTATGCTTTGCAAGGAATTCGTAAATAGTTTAAA
TTGATAATTAACTTTTTTTAAACTAATCATGTTTTATGAAAACTTAAAATAGGAATAAAA
TAAAGTAAGTTATATATTAGTAGATCTTTAACAGCTATATGTTTTCCATGTTTGACATAA
TACAATTCAGGTTAAATGTGATAAATATTGGCCAAGCCAAGGATAGATCTTATAGGAGGG
AGATTTGCAAGTCCAATTTTTATCGTAGTAAAAAAATGCATAATAGAATATTATTGAAAG
ACAATTCATACTCAAGTATAAAAATGAATAACGTTAAGTCTCTTAAGTGCATGTATAATT
ATCATATTCAGGTTACTAATAAGTTTCATAAAATACATTTTATTTAAAAAAGTGGGAAGG
ATGGCCAGATCATGGTGTTCCTGAAAGTAGAGATTATGGAGTTTTAGAAAATTTAGTATA
AAGGGTAGTAAATCAAATTGAATAGTCCAAGATTCCTGTCGTGCATTGCAGGTAATATTA
GAAAAAAATATAAATAAAATTAGATATGTATACATGTATAAAAAGTGCTGGAGTTGGTAG
AACTGGTACATTGTTAGCCCTCTCTAATATTTACATGACTTTGAAATATCATTAAGTTAA
AAGTAAGATAGATTATTTTTTGTAATTTCTATTCATAATAAGTTTACTTTTTATTTAACG
CACAGAAACTCCTATAGACTAAATAGAATTAAACGTCTTAGATATAGTTAGAAGACTTAG
AGAGTAAAGAATGATCATGGTATAAATGGATAACTAATTAAACTTAGTATATGAAATTAC
AAAAACTTTTATCAGAAAAATGTTCAAATTTTGA


>TTHERM_00564190(protein)
MDTKNNLQQEEAFYEKFAVPPAPIKKEEIDYSYTEELKAETRKIKDLLNFKMTNQFQVLQ
MITHTNNHHNNRIKANEFLDYNRYTDILPYKHSVVKISGSTQVDQYINANYINNPFKDKA
YIATQGPIPNTISSFWRMIWEQKTNLIIMLCKEFVKCDKYWPSQGQILQEGDLQVQFLSQ
QKNAQQNIIERQFILKYKNEQRQVSQVHWEGWPDHGVPESRDYGVLENLVQRVVNQIEQS
KIPVVHCSAGVGRTGTLLALSNIYMTLKYHQVKKTPIDQIELNVLDIVRRLREQRMIMVQ
MDNQLNLVYEITKTFIRKMFKF