Identifiers and Description

Gene Model Identifier

TTHERM_00564440

Standard Name

CTH35 (CaTHepsin 35)

Aliases

PreTt08982 | 75.m00180 | 3721.m00062

Description

CTH35 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF07722 ) Peptidase C26

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14597.1 9.997093137033517e-262
Description: papain family cysteine protease containing protein (949 aa)
Oxytricha Contig19133.0.g74 4.0014960278073076e-143
Description: Papain family cysteine protease
DictyBase DDB_G0283401 1.9994274381022833e-63
Description: ctsZ on chromosome: 4 position 613897 to 615290
Stentor Coeruleus SteCoe_27940 2.3455513385429143e-59
Description: None
WormBase WBGene00000788 1.0002546821282671e-50
Description: locus:cpz-1 status:Confirmed UniProt:G5EGP8 protein_id:CCD70407.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00564440(coding)
ATGAAGTCAAGATTAAAATTAGAAATACTTGCAATTGTTTTTGCTCTAAGTATTTATGGC
ATCGCAGGTAAAACAAATCATATTAGCAAAGATTTTAAATAATCAGAACTTCCTACTCAA
TTTTCTTGGGCAAGTGTAAATGGAGTTAACTATTTGAGTTACGTAAGAAACTAATTAGCT
CCTAGATTATGTGATTCTGGATGGGCTTTTTCTGTTACTTCTTCACTAAATGATAGAATA
AAAATTAAAAGGCAAAATGCTGGGCCTGATTTTATTCTTTCTCCTTAAGTTTTAATTTCT
TGCAATGATGACAGTAATGGATGTCGTGGAGGATCTCCATAAACAGCATACGAATATATT
TTGAGAAACAACATTACTGATGAAACATGCTCTCCTTATACTGGTAGAGATTTTAGAGAT
GGCTATTAATGCAGCTCACTAACTGTTTGTATGGAATGCTGGCCAAAAGTAGGGTGCAAA
GCTAGAGATGATGCTTACATTTATTCAATTGAAAGTTGGGATTAAGTTAAAGGTGAAGAA
GATATGTAATAAGAAATATTTAATCATGGTCCCATTTCTTGCGTAATTAACTCTACAGAA
GATTTTAGAAACTACACTGGTGGAATACTAAATCCTCCAGATTCTCCTGTTTAAATTACA
CATTCTTTAAGCATTGTTGGTTGGGGTGAAGATGAGAAGTAAACTAAATATTGGATTGCT
AGAAACTCTTTAGGCACATTTTGGGGAGAAAATGGATTCATCAGAATTATTAGAGGTAAA
AATGCTCTTAAAATTGAAAGTGATTGCTCCTATGGTAGAATTAGAGATACATGGAGCTAA
TAAATAAGAAATAACACCTCGTTTAGCAAGAGCAATTCTAGTTATACTTCAAATAATTAA
TAGGAACACAAAATTAATTTAGATATCAATTCTAAATCTGAAAAAAATATTATTTAGTAA
GCTAAAGATGAGTTAAAGCAAATCTTTTAAGAGTCATATCAGAAATATCAACCTTTAATT
GAATCTATTTCTAGTAGCTTTAGTAATAACATAGAATTAGATGTGAGTACCCTTCCTACC
AATTTTACTTGGGGTAATGTAAACGGAGTTAATTACTTAACTTAAATAAAAAACCAACAT
AATCCATAGTATTGTGGGGGATGCTGGTCTTTTGCTGTTACAAGCAGCTTGTAGGATAGA
ATAAAAATTGCACGCAATAGAACAGATATTCCTGATGTAATTCTTTCAAATCAGATGATT
ATAAATTGCCATTTAGGTGGTTCCTGCTTTACTGGAGGAGTTTCATTGATAACCTACTAT
TTCCTTTCATAAATTGGAGTTGTTGAAGATTCTTGTATGCCTTACTAAGCGAAAGATTAA
TGGCTTCCTGTTTGCAATACCAAATAATAATGTATTTCATGTGAGCTTCCTTCTGCTCCT
ATCAGTAACACAACTGATATATCTTCTATCTGTCCAGCTCAAACAAAGTATCCTTACAAG
AAATGGAAAGTAAGTAAGTTTGGACACATTACAGGTGTAAAGTAAATGAAAAGCGAAATA
TATTCTAGAGGACCTATTTCTTGTACCATTGATGCCACTGATAATTTAGAAAATAATTAC
ACAGGTGGTATTTACAGTGAAAAAGTTAAGTTACCTATACCCAATCACTATGTGTCTGTA
GTTGGATGGGGTTAGACTTTAGAAGGTGAGGAATACTGGATAGTTAGAAATTCTTGGGGA
ACCTATTGGGGAGAGGAAGGATTTTTTAAGTTAAAAATGCACAAAGACAATTTGGGTTTA
GAATTTGGTTGCTCTTGGGGAGTTATAGATCTTTAATAATGA


>TTHERM_00564440(gene)
ATGAAGTCAAGATTAAAATTAGAAATACTTGCAATTGTTTTTGCTCTAAGTATTTATGGC
ATCGCAGGTAAAACAAATCATATTAGCAAAGATTTTAAATAATCAGAACTTCCTACTCAA
TTTTCTTGGGCAAGTGTAAATGGAGTTAACTATTTGAGTTACGTAAGAAACTAATTAGCT
CCTAGATTATGTGATTCTGGATGGGCTTTTTCTGTTACTTCTTCACTAAATGATAGAATA
AAAATTAAAAGGCAAAATGCTGGGCCTGATTTTATTCTTTCTCCTTAAGTTTTAATTTCT
TGCAATGATGACAGTAATGGATGTCGTGGAGGATCTCCATAAACAGCATACGAATATATT
TTGAGAAACAACATTACTGATGAAACATGCTCTCCTTATACTGGTAGAGATTTTAGAGAT
GGCTATTAATGCAGGTAACACAATTATAATATAATTTAATAATGAATGATTTTAAAAATT
AACTTAACTCAAAAATTTTAAAGGTTCAATTTTTAAATTTTAACCTATTTTTTACATAAA
TTAGCTCACTAACTGTTTGTATGGAATGCTGGCCAAAAGTAGGGTGCAAAGCTAGAGATG
ATGCTTACATTTATTCAATTGAAAGTTGGGATTAAGTTAAAGGTGAAGAAGATATGTAAT
AAGAAATATTTAATCATGGTCCCATTTCTTGCGTAATTAACTCTACAGAAGATTTTAGAA
ACTACACTGGTGGAATACTAAATCCTCCAGATTCTCCTGTTTAAATTACACATTCTTTAA
GCATTGTTGGTTGGGGTGAAGATGAGAAGTAAACTAAATATTGGATTGCTAGAAACTCTT
TAGGCACATTTTGGGGAGAAAATGGATTCATCAGAATTATTAGAGGTAAAAATGCTCTTA
AAATTGAAAGTGATTGCTCCTATGGTAGAATTAGAGATACATGGAGCTAATAAATAAGAA
ATAACACCTCGTTTAGCAAGAGCAATTCTAGTTATACTTCAAATAATTAATAGGAACACA
AAATTAATTTAGATATCAATTCTAAATCTGAAAAAAATATTATTTAGTAAGCTAAAGATG
AGTTAAAGCAAATCTTTTAAGAGTCATATCAGAAATATCAACCTTTAATTGAATCTATTT
CTAGTAGCTTTAGTAATAACATAGAATTAGATGTGAGTACCCTTCCTACCAATTTTACTT
GGGGTAATGTAAACGGAGTTAATTACTTAACTTAAATAAAAAACCAACATAATCCATAGT
ATTGTGGGGGATGCTGGTCTTTTGCTGTTACAAGCAGCTTGTAGGATAGAATAAAAATTG
CACGCAATAGAACAGATATTCCTGATGTAATTCTTTCAAATCAGATGATTATAAATTGCC
ATTTAGGTGGTTCCTGCTTTACTGGAGGAGTTTCATTGATAACCTACTATTTCCTTTCAT
AAATTGGAGTTGTTGAAGATTCTTGTATGCCTTACTAAGCGAAAGATTAATGGCTTCCTG
TTTGCAATACCAAATAATAATGTATTTCATGTGAGCTTCCTTCTGCTCCTATCAGTAACA
CAACTGATATATCTTCTATCTGTCCAGCTCAAACAAAGTATCCTTACAAGAAATGGAAAG
TAAGTAAGTTTGGACACATTACAGGTGTAAAGTAAATGAAAAGCGAAATATATTCTAGAG
GACCTATTTCTTGTACCATTGATGCCACTGATAATTTAGAAAATAATTACACAGGTGGTA
TTTACAGTGAAAAAGTTAAGTTACCTATACCCAATCACTATGTGTCTGTAGTTGGATGGG
GTTAGACTTTAGAAGGTGAGGAATACTGGATAGTTAGAAATTCTTGGGGAACCTATTGGG
GAGAGGAAGGATTTTTTAAGTTAAAAATGCACAAAGACAATTTGGGTTTAGAATTTGGTT
GCTCTTGGGGAGTTATAGATCTTTAATAATGA


>TTHERM_00564440(protein)
MKSRLKLEILAIVFALSIYGIAGKTNHISKDFKQSELPTQFSWASVNGVNYLSYVRNQLA
PRLCDSGWAFSVTSSLNDRIKIKRQNAGPDFILSPQVLISCNDDSNGCRGGSPQTAYEYI
LRNNITDETCSPYTGRDFRDGYQCSSLTVCMECWPKVGCKARDDAYIYSIESWDQVKGEE
DMQQEIFNHGPISCVINSTEDFRNYTGGILNPPDSPVQITHSLSIVGWGEDEKQTKYWIA
RNSLGTFWGENGFIRIIRGKNALKIESDCSYGRIRDTWSQQIRNNTSFSKSNSSYTSNNQ
QEHKINLDINSKSEKNIIQQAKDELKQIFQESYQKYQPLIESISSSFSNNIELDVSTLPT
NFTWGNVNGVNYLTQIKNQHNPQYCGGCWSFAVTSSLQDRIKIARNRTDIPDVILSNQMI
INCHLGGSCFTGGVSLITYYFLSQIGVVEDSCMPYQAKDQWLPVCNTKQQCISCELPSAP
ISNTTDISSICPAQTKYPYKKWKVSKFGHITGVKQMKSEIYSRGPISCTIDATDNLENNY
TGGIYSEKVKLPIPNHYVSVVGWGQTLEGEEYWIVRNSWGTYWGEEGFFKLKMHKDNLGL
EFGCSWGVIDLQQ