Identifiers and Description

Gene Model Identifier

TTHERM_00566710

Standard Name

MRNC42 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt09011 | 75.m00209 | 3721.m00089

Description

MORN motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14628.1 9.997093137033517e-262
Description: hypothetical protein (399 aa)
Oxytricha Contig13677.0.1.g35 1.9999788875029746e-125
Description: MORN repeat
Stentor Coeruleus SteCoe_9900 8.408597124803643e-50
Description: None
DictyBase DDB_G0349488 2.99851380290819e-19
Description: DDB_G0349488 on chromosome: 2 position 6912714 to 6914186
WormBase WBGene00002179 0.0000000400154582995175
Description: locus:jph-1 status:Confirmed UniProt:Q22667 protein_id:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00566710(coding)
ATGGGTAACTGTGCTGCTTGCGAAGATACATAAGAATTTGATCAAAACACAGAAGTCAAT
CTCTAAAAGAAAAAGAGAATCCAAGAAAATTTTTAAAACATGGAAAAAGAATAATATGAT
GAAAATGAATTTGGAAAAGAAAATGTATTTTAAAATAAAGAAACTGAAAAAGTAAAAAGG
TCTGGAAAGCATGACGATTATCAATCTTTAGCAGGCTCAAGAGTGGATTAGTTAAATTCT
TCAACCAAAAAAGAAAGGTTGAACCCACTATCTGCTTCAAAAGGGTTTTAAAACGGTTAA
TAATAATCAGTGAACAGCAACAGATAGTCAGCAAATAAATTAGATGAAACCGGTGATCAC
ATTCCACCTCATTTAAATAAATTAGATTAACTTCCTGATTTTTCAAACGAATTTACAAGA
GAAGTGCTGGAAAAACTTGGCGAATTCGTATATGACTAAGATGAAGAAGAGTCATTCCTT
GACCTACCATTCTTTGGACCATGTGAAATGGAAAACAATGCTTTTTACATCGGATAGTGG
AAGCACGGATAGAGATGGGGAAGAGGTAAATAAGTATGGAGTGATGGGTCTTAATACGAA
GGTTATTGGAAAAATGATATGGCTAATGGAAAAGGTAGACTTATACATGCAGATGGAGAT
GTCTTTGAAGGAAATTGGCTAAATGATAAAGCTCATGGCAAAGGTGTTTATATTCATAGA
GATGGAGCTAGTTATTCAGGTGATTGGTTTGAAGATAAATAGCATGGATTTGGAGTCGAA
AAATGGATAGATGGAGCTAGCTATGAAGGAAATTATTTTATGGGTATGAAGCATGGGCAT
GGTGTCTTTACTTGGGCTGATGGTAGTATATATAAGGGAGAATTCTAAAATAATAATATA
GATGGCAGAGGAAGTTACAAATGGGCTGATGGTAGAGAGTATGACGGTACTTGGAGAGAC
AATAAAATGCACGGAAAGGGTGTTTTTACATGGAAAGATGGAAGAAAATATATAGGAGAA
TATATAGATGATAAAAAACATGGATTAGGGGAATTTTACTGGCCAGATGGTAGAGTGTAT
AAAGGATATTGGGAGAATGGAAAATAGCATGGAAGAGGATTTTATAAAGGTTCAAACGGT
AGAGAAAGAGAAGGAGAGTGGAAAGAGGGTAAAAAAATTAGATGGCTTGATGAATGA


>TTHERM_00566710(gene)
ATGGGTAACTGTGCTGCTTGCGAAGATACATAAGAATTTGATCAAAACACAGAAGTCAAT
CTCTAAAAGAAAAAGAGAATCCAAGAAAATTTTTAAAACATGGAAAAAGAATAATATGAT
GAAAATGAATTTGGAAAAGAAAATGTATTTTAAAATAAAGAAACTGAAAAAGTAAAAAGG
TCTGGAAAGCATGACGATTATCAATCTTTAGCAGGCTCAAGAGTGGATTAGTTAAATTCT
TCAACCAAAAAAGAAAGGTTGAACCCACTATCTGCTTCAAAAGGGTTTTAAAACGGTTAA
TAATAATCAGTGAACAGCAACAGATAGTCAGCAAATAAATTAGATGAAACCGGTGATCAC
ATTCCACCTCATTTAAATAAATTAGATTAACTTCCTGATTTTTCAAACGAATTTACAAGA
GAAGTGCTGGAAAAACTTGGCGAATTCGTATATGACTAAGATGAAGAAGAGTCATTCCTT
GACCTACCATTCTTTGGACCATGTGAAATGGAAAACAATGCGTAATTATTAAAGATTTTA
TTAATAATTTGACAGTTAATAGCAAATAAAATAGTTTATTTTTGAAATAAAAAGCCAAGC
TAAAAAAATGATTTTATTATCAGCAACTAAAATAGATTAAATTAATTTAGAGATTTAAAA
TATGTTTAGTTTAATAAAAGTAATAGAAAGCAGATTTAAAAAAATTTATAGATCGACTTG
ATTTATTTTAATGAATTTTTTGAAAAGTTAATTCTTTATCAAGTTTTTTATTTAGTTAAT
GTTTAAAAAAATAATCATATAAAGAATATTGAGGCAATCTAAAACCTTTCTGATTAATAT
TCTAAAATCTATAAAATTTGCATTCTTTTTTTCTTTTTTTCTCTTTTTCTAATTTTCTTT
TTCACTTTTAAAAAAATATTTATTTATTTTTTTTTGAAATCAAAAGTTTTTACATCGGAT
AGTGGAAGCACGGATAGAGATGGGGAAGAGGTAAATAAGTATGGAGTGATGGGTCTTAAT
ACGAAGGTTATTGGAAAAATGATATGGCTAATGGAAAAGGTAGACTTATACATGCAGATG
GAGATGTCTTTGAAGGAAATTGGCTAAATGATAAAGCTCATGGCAAAGGTGTTTATATTC
ATAGAGATGGAGCTAGTTATTCAGGTGATTGGTTTGAAGATAAATAGCATGGATTTGGAG
TCGAAAAATGGATAGATGGAGCTAGCTATGAAGGAAATTATTTTATGGGTATGAAGCATG
GGCATGGTGTCTTTACTTGGGCTGATGGTAGTATATATAAGGGAGAATTCTAAAATAATA
ATATAGATGGCAGAGGAAGTTACAAGTAAGAAAATATTACACTTGATGATATAATAATTG
CCTAATCATTAATTTATTTAACTTAATTACTATAATATAGATGGGCTGATGGTAGAGAGT
ATGACGGTACTTGGAGAGACAATAAAATGCACGGAAAGGGTGTTTTTACATGGAAAGATG
GAAGAAAATATATAGGAGAATATATAGATGATAAGTAATATTAGCATAATTATTCAATAA
TAACAAAAATTTCTTTAAAATAGAAAACATGGATTAGGGGAATTTTACTGGCCAGATGGT
AGAGTGTATAAAGGATATTGGGAGAATGGAAAATAGCATGGAAGAGGATTTTATAAAGGT
TCAAACGGTAGAGAAAGAGAAGGAGAGTGGAAAGAGGGTAAAAAAATTAGATGGCTTGAT
GAATGA


>TTHERM_00566710(protein)
MGNCAACEDTQEFDQNTEVNLQKKKRIQENFQNMEKEQYDENEFGKENVFQNKETEKVKR
SGKHDDYQSLAGSRVDQLNSSTKKERLNPLSASKGFQNGQQQSVNSNRQSANKLDETGDH
IPPHLNKLDQLPDFSNEFTREVLEKLGEFVYDQDEEESFLDLPFFGPCEMENNAFYIGQW
KHGQRWGRGKQVWSDGSQYEGYWKNDMANGKGRLIHADGDVFEGNWLNDKAHGKGVYIHR
DGASYSGDWFEDKQHGFGVEKWIDGASYEGNYFMGMKHGHGVFTWADGSIYKGEFQNNNI
DGRGSYKWADGREYDGTWRDNKMHGKGVFTWKDGRKYIGEYIDDKKHGLGEFYWPDGRVY
KGYWENGKQHGRGFYKGSNGREREGEWKEGKKIRWLDE