Identifiers and Description

Gene Model Identifier

TTHERM_00571860

Standard Name

ATP1 (ATP synthase 1)

Aliases

PreTt10516 | 76.m00218 | 3810.m02075

Description

ATP1 ATP synthase F1 alpha subunit; ATP synthase F1- alpha subunit family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_5903 0
Description: None
WormBase WBGene00010419 9.997093137033517e-262
Description: ATP synthase subunit alpha, mitochondrial status:Confirmed UniProt:Q9XXK1 protein_id:CAA19429.1
Tetrahymena borealis EI9_03424.1 9.997093137033517e-262
Description: ATP synthase F1, alpha subunit protein (547 aa)
DictyBase DDB_G0294012 9.997093137033517e-262
Description: atp1 on chromosome: M position 15103 to 16662
Oxytricha Contig20211.0.g80 9.997093137033517e-262
Description: ATP synthase alpha/beta family, nucleotide-binding domain
SGD YBL099W 9.997093137033517e-262
Description: ATP1 Alpha subunit of the F1 sector of mitochondrial F1F0 ATP synthase, which is a large, evolutionarily conserved enzyme complex required for ATP synthesis; phosphorylated

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00571860(coding)
ATGATCAGAAACTTCCACAGTTTAGTCAAGAGAGTACCTAGACTCGCTCTTACTCCCTTC
TTCGGCTTCAGAACTTCCATGACTTTAGCCGATAAGAAGTTATCCACTGGTGAAGCCTCC
GTTGTCCTCGCCGAAAAGATTAAGGGAATCACTCAATAGAACGATATTACTGAATACGGT
ACAGTTATTTCAATTGGTGATGGTATTGCAAGAGTCTTTGGTTTGACTAAGGTCTAAGCA
GGTGAAATGGTTGAATTTAAGTCTGGTATTAGAGGTATGGCCCTTAACTTGGAAACTGAT
AACGTCGGTGTTGTCGTTTTGGGTAATGATAGAGATATTAAGGAAGGTGATGTCGTCAAG
AGAACTGGTGCCATCGTCGATGTCCCCATTGGTGAAGCTATGTGCGGAAGAGTCTTCGAT
GCCTTAGGTAACCCCATTGACGGTCTTGGTCCTCTTAAGACCACCCAAAGAGCCAGAGTT
GAAATCAAGGCTCCCGGTATTATTCCCAGACAATCCGTCAGACAACCTATGTAAACTGGT
ATTAAGTGTGTCGACTCCCTCGTCCCTATCGGTAGAGGTTAAAGAGAACTTATTATTGGT
GATAGATAAACTGGTAAGACTGCTATCGCTATCGATACCATCCTCAACCAAAAGGAAGCC
TTCAACACTGGTGATGTCAAGAAGTAATTATATTGCATTTACGTCGCCGTCGGTCAAAAG
AGATCTACCATTGCTAACTTGGTCTCCATCCTTAAGTAACACGATTGCATGAAGTTCACC
ATCGTCGTTTGCGCTACTGCTTCTGATGCTGCTCCCCTTTAATTCTTGGCTCCTTACTCT
GGTTGCGCCATCGGTGAATTCTTCAGAGATAACGGCAAGCACGCTTTAATTATCTACGAC
GATCTTTCCAAGCAAGCCGTCGCTTACAGACAAATGTCTTTGTTGTTGAGAAGACCTCCT
GGTAGAGAAGCTTATCCTGGTGATGTCTTCTATCTCCATTCTCGTCTTTTGGAAAGAGCC
GCTAAGATGAACGACAGCCTCGGTGGTGGTTCCTTGACTGCCTTGCCCGTCATTGAAACC
CAAGCTGGTGATGTCTCTGCTTATATTCCCACCAACGTTATTTCCATTACTGATGGTTAA
ATTTTCTTAGAAACTGAACTTTTCTACAAGGGTATCAGACCTGCCATTAACGTCGGTCTT
TCCGTCTCTAGAGTCGGTTCTGCCGCTTAAATTAAGGCCATGAAGAAGATTGCCGGTAAC
TTAAAGCTTACCCTCGCTACCTACAGAGAACTTGCTGCTTTCTCCCAATTCGGTTCTGAT
TTGGATGCCAAGACCCAATAATAATTGAACACTGGTGAAAGATTAGTTGAAATGTTAAAA
CAAAACTAATATACCCCCATGAAGGTCGAAGAATAAGTTTGTATTATTTTTGCTGGTGTC
AAGGGATTCTTAGATGCCCTCGTCACTTCTGAAGTCTTGAAGTTCGAAAAGAAGTTCCTT
GAACACGTCAGAACTAACCACTCTGCTCTCCTTAAAAGAATTAGAGACTCTGGTGATCTC
AGCGAAGTTGATACTAATGAACTCAACACTATTATTCCTCTCTTCATCCAAGAAGGTGGT
TTCAAGCTCAAGGCCTAATGA


>TTHERM_00571860(gene)
ATGATCAGAAACTTCCACAGTTTAGTCAAGAGAGTACCTAGACTCGCTCTTACTCCCTTC
TTCGGCTTCAGAACTTCCATGACTTTAGCCGATAAGAAGTTATCCACTGGTGAAGCCTCC
GTTGTCCTCGCCGAAAAGATTAAGGGAATCACTCAATAGGTAAATATTCTTAAGAAAATA
ATTACATCTCTCATTGATTGAGTTAGGGGTTCTCAACTAAGTAATTATAAAAAACAAAGA
AAACCAAACCATATCTTTCAAAAAAGCAACAAAATTGAATTAAATCTAAATAGCCTAGAC
AACATAAAAAAAGAAGCATTAAAAAGTAAAACCATTAGAGGGATTAGACAAGATTTATAT
ATTCCATTGCTCATAAAAATAATAGTTTGCTTTGTTTTGGATATTTATTTGTATAGAGTT
ATTCCCAAATCAAACTAAGAAAAAACAAAGAGAAGATACCTTTTTTCCTTTCTTTTTATC
TTCTCTTTACCTATCAAGAAAGAAAGATATATAGGTGTCAATGAAATCGAATGCTAAACA
ACCCACATTTAGAGCAAAGTACTTAAATGGTGGCAATAATTTAGAGCAAGAAAAGAAAGC
CTTTCATAGTTTTATTTGCGATTAACTATATTATTTAGAAGCAAGCATATTTAAAAACCT
TAAATCAAATGATCGATCAATCGATTTTATTTATGATTACGCAGATCAATAAAAAAGATG
AGAGATTTTATAGAGAATGTGATAACGATGAAATTTACCTTTATTTTTTTTAACAATATA
AAGAACGATATTACTGAATACGGTACAGTTATTTCAATTGGTGATGGTATTGCAAGAGTC
TTTGGTTTGACTAAGGTCTAAGCAGGTGAAATGGTTGAATTTAAGTCTGGTATTAGAGGT
ATGGCCCTTAACTTGGAAACTGATAACGTCGGTGTTGTCGTTTTGGGTAATGATAGGTAA
AAAATTCATCCCTTTTTAAATAGCTAAAAAGCATCTGTCAAAAAGCTTTCAAGCAACATT
CATTTTTACTTCATTTCCAATCAACTACCGCATTTTCTCTCTTTTATGGGCTCTTTCAGT
ATCAATTGATTAAAATATCAATCAAATTACCTACTTTTTCGAAAGATACTTAAAAATACA
ATAAAAAAGTCAATAAAAATATGAAAAACAATATTTTATTCACAAATTCAAAAAAAGTAT
TTAAGTTTGAACCATGAGTTTCATTAAGGATAATTTAGATCATCATCAATAAATTTAGTA
AGCATCACTTGCTTCCAATAAATATGAAGCAAAGATTTAATTATGAAGAGCGTACGTTAT
TTGCCATAGTTATTTAAAATGATAAAGTTCATCAACATTAATAATTATTGAGAAAATAAG
TGAGTGAGTTGATTGAAAGTGTTCATTAATTGAAAATAAGTGGTCTTATTTTATTTAAAA
TATGATAGAGATATTAAGGAAGGTGATGTCGTCAAGAGAACTGGTGCCATCGTCGATGTC
CCCATTGGTGAAGCTATGTGCGGAAGAGTCTTCGATGCCTTAGGGTAAATTATTTAAACC
TACCGAAATATTTGATCATATTTTTAATGCTTCTCTTTTAAATTTTAATAGTAACCCCAT
TGACGGTCTTGGTCCTCTTAAGACCACCCAAAGAGCCAGAGTTGAAATCAAGGCTCCCGG
TATTATTCCCAGACAATCCGTCAGACAACCTATGTAAACTGGTATTAAGTGTGTCGACTC
CCTCGTCCCTATCGGTAGAGGTTAAAGAGAACTTATTATTGGTAATTACTTAATTGATTG
TTTATTTTACTTGCTTCTTATATGCTTGCTTACAATATCCTTAAATCCATTCATCACTAT
CCTTCCATCGCTCATCTTTTTAAATCGATAATCTTAAAATTAAGTCGATTTAAGAAAATA
TCATTTTACCAGAAAATAAAATTAAGAGGAATCAAAGAATGAAAATTAATAATTTAAAAA
CTAATCATAATATTGAGTGACAAACTAAGTACATAAACATAACAAAAAATAATTAGAAAG
TTGATAGATTAGCTTTTAAGATAAATACTCTTTGACTTTATATAAACAAAAAAAAAGAAT
ACAGATTTTATTAATTTGGATTGTTTTACCTTATTTATCCCTTAATAATTTATTTTCATT
TTACTTTTTAATAGAAAAAAGGGGAAATAAATAAATAAAAAAATTAATTAATATAAATAA
ATAAGCAAATAAAAATCAGAAAAGAAGGAAAAAAGATTCCCTTTTTTGGATTTTTAATTT
TAATTCTTTGATCCTTTTAAAAATCAATAATTTTTTATTTATTGATAAATCTTTTTTAAG
TTGGAAGATAAATTGATTGATTTTAATTATTACTTTGAATTCATTTTAGAGAACCTAATA
AAGAGCGTTTTACTCTTAAAATTTTGAAAATAAGCAAATTCTCTAGTTTAAAATCTGTAA
AATAACGTTGAGAATATTTATCTACTAATATATTTTTAATTCAACAAATTTAACTAAAAT
AAATTGCATATTTTATAAATTGATCAGACTATTCAATAGATATTTTAGCAAATAAAATAG
GTTTAATTAAAATTAGAATTGATCAATACAATTTTAAGTAGAAATTGCAAGCATTTTTTA
ATAACTAAATAAGTGATACTTTTGAATTTAAAATTAATTTATTTTTTAACTAAATTAGGT
GATAGATAAACTGGTAAGACTGCTATCGCTATCGATACCATCCTCAACCAAAAGGAAGCC
TTCAACACTGGTGATGTCAAGAAGTAATTATATTGCATTTACGTCGCCGTCGGTCAAAAG
AGATCTACCATTGCTAACTTGGTCTCCATCCTTAAGTAACACGATTGCATGAAGTTCACC
ATCGTCGTTTGCGCTACTGCTTCTGATGCTGCTCCCCTTTAATTCTTGGTAAAAATGAAT
TCAAAATTAATTTCCTTACTTTAAAAGCTTTAAAAAGAAATTATTTAATTATCACACTTT
TATAGTAATTGACTAAAAATTCAAATTGAAATTTAGATTAAATTAGATAAAATAATTTAA
TTAATTTTAAACAATTTTTACTAAATTATGAAATTTATTAAAAATTTTCTAATTAAAAAA
AGGCTCCTTACTCTGGTTGCGCCATCGGTGAATTCTTCAGAGATAACGGCAAGCACGCTT
TAATTATCTACGACGATCTTTCCAAGCAAGCCGTCGCTTACAGACAAATGTCTTTGTTGT
TGAGAAGACCTCCTGGTAGAGAAGCTTATCCTGGTGATGTCTTCTATCTCCATTCTCGTC
TTTTGGAAAGAGCCGCTAAGATGAACGACAGCCTCGGTGGTGGTTCCTTGACTGCCTTGC
CCGTCATTGAAACCCAAGCTGGTGATGTCTCTGCTTATATTCCCACCAACGTTATTTCCA
TTACTGATGGTTAAATTTTCTTAGAAACTGAACTTTTCTACAAGGGTATCAGACCTGCCA
TTAACGTCGGTCTTTCCGTCTCTAGAGTCGGTTCTGCCGCTTAAATTAAGGCCATGAAGA
AGATTGCCGGTAACTTAAAGCTTACCCTCGCTACCTACAGAGAACTTGCTGCTTTCTCCC
AATTCGGGTAAATAGATTTACAAATAAATTAACTGATCAATAACAAAAAATTAAAAAATA
CAAAAATAATTTTGACTTATTTTTAAATTTATAATATAAAAGTTCTGATTTGGATGCCAA
GACCCAATAATAATTGAACACTGGTGAAAGATTAGTTGAAATGTTAAAACAAAACTAATA
TACCCCCATGAAGGTCGAAGAATAAGTTTGTATTATTTTTGCTGGTGTCAAGGGATTCTT
AGATGCCCTCGTCACTTCTGAAGTCTTGAAGTTCGAAAAGAAGTTCCTTGAACACGTCAG
AACTAACCACTCTGCTCTCCTTAAAAGAATTAGAGAGTAAGATTTTATTTTGTTTTCTTC
AAGATATTTAAAAAAAGAGCACTCAATTTCATCTTCATGCATTTTGGGTTGTTTAAATAA
AAAAAAATATTTTAAATTGCTTTTTTTTTTGAAATATTTTTAAACTTAATTTATTAAATT
AATTAATTATAGCTCTGGTGATCTCAGCGAAGTTGATACTAATGAACTCAACACTATTAT
TCCTCTCTTCATCCAAGAAGGTGGTTTCAAGCTCAAGGCCTAATGA


>TTHERM_00571860(protein)
MIRNFHSLVKRVPRLALTPFFGFRTSMTLADKKLSTGEASVVLAEKIKGITQQNDITEYG
TVISIGDGIARVFGLTKVQAGEMVEFKSGIRGMALNLETDNVGVVVLGNDRDIKEGDVVK
RTGAIVDVPIGEAMCGRVFDALGNPIDGLGPLKTTQRARVEIKAPGIIPRQSVRQPMQTG
IKCVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKEAFNTGDVKKQLYCIYVAVGQK
RSTIANLVSILKQHDCMKFTIVVCATASDAAPLQFLAPYSGCAIGEFFRDNGKHALIIYD
DLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDSLGGGSLTALPVIET
QAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQIKAMKKIAGN
LKLTLATYRELAAFSQFGSDLDAKTQQQLNTGERLVEMLKQNQYTPMKVEEQVCIIFAGV
KGFLDALVTSEVLKFEKKFLEHVRTNHSALLKRIRDSGDLSEVDTNELNTIIPLFIQEGG
FKLKAQ