Identifiers and Description

Gene Model Identifier

TTHERM_00572010

Standard Name

GST57 (Glutathione S-transferase omega 3, TtGSTo3, GSTo3)

Aliases

PreTt10531 | 76.m00233 | 3810.m02091

Description

GST57 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03412.1 5.999326315775399e-131
Description: glutathione S-transferase domain-containing protein (260 aa)
WormBase WBGene00001790 0.00000000000009996062864481225
Description: locus:gst-42 Probable maleylacetoacetate isomerase status:Confirmed UniProt:Q18938 protein_id:CAA91449.1
Oxytricha Contig19947.0.g22 0.0000000006999585478469937
Description: Glutathione S-transferase, N-terminal domain
DictyBase DDB_G0278155 0.0000000029989608248573072
Description: mai on chromosome: 3 position 376116 to 376878

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00572010(coding)
ATGTCTTAATTAACATTATATGGCTTTCTCCTCTGCCCTTATGTATAAAGAGTGAGATTC
GCTTTAGAAAAAATTGGAGTTAAGTATGACTACAAAGAAATTGACCTCTTCAAGCTTAAA
TAGAAAGAATAGGCCTACTTAGATATTAACCCTTTTGGAAAGGTTCCTACAATAGTTATT
AATAACCAGATTGTATATGAAAGTCTTCCTCTTCTTGAATTCCTTGAAAATGAATTTGGC
AGCGTCTTCCCTTAAGATAACATCAGAAAAACTTAATAGAGAATTTGGACAACTTATTTT
GATTAAAATTTTATTAGTAAAATGTGGGGAATCTTTAGTCTTATAAAAACAAAGGATGTT
GAAGGATCTAAAAAACTTGCTAACGAACTAGCTGAAATATTGAGATTCTTTACTTTAAAT
TCAAAATTATCTGAAAGAATTAAATAGAATCCTAGCAGCTATTTTGAAGGAGATACTTTA
ACTTATGCTGATTTTGCTATTATCCCTCATGTTAAAGTACTAGAAACTAACTATAAAATA
TTCTTTAAAAGCAGTTTATTTGAATAAATTGAAAACTAGGATGAGTTAATCTAGAATTTC
AAAACCTATTATTAAAATGTTGTTTCTTCTGATTCATTCAAAAGGGCTGTAACTAATCCT
GTTACACTACCTCCATAAGGAGACAATTTCGTTTTAGATGAGTTATAATACACAACTGAA
AACTTTAATTATGAAAACCTTTCAGAAACTTACATGAATAAAAAATTCGCATAAGCTTGA


>TTHERM_00572010(gene)
ATGTCTTAATTAACATTATATGGCTTTCTCCTCTGCCCTTATGTATAAAGAGTGAGATTC
GCTTTAGAAAAAATTGGAGTTAAGTATGACTACAAAGAAATTGACCTCTTCAAGCTTAAA
TAGAAAGAATAGGCCTACTTAGATATTAACCCTTTTGGAAAGGTTCCTACAATAGTTATT
AATAACCAGGTATTTATTTATAAATTTACAGTCTTTAAATCTTCTAACTTAACATTTATT
ATATTAATTAGATTGTATATGAAAGTCTTCCTCTTCTTGAATTCCTTGAAAATGAATTTG
GCAGCGTCTTCCCTTAAGATAACATCAGAAAAACTTAATAGAGAATTTGGACAACTTATT
TTGATTAAAATTTTATTAGTAAAATGTGGGGAATCTTTAGTCTTATAAAAACAAAGGATG
TTGAAGGATCTAAAAAACTTGCTAACGAACTAGCTGAAATATTGAGATTCTTTACTTTAA
ATTCAAAATTATCTGAAAGAATTAAATAGAATCCTAGCAGCTATTTTGAAGGAGATACTT
TAACTTATGCTGATTTTGCTATTATCCCTCATGTTAAAGTACTAGAAACTAACTATAAAA
TATTCTTTAAAAGCAGTTTATTTGAATAAATTGAAAACTAGGATGAGTTAATCTAGAATT
TCAAAACCTATTATTAAAATGTTGTTTCTTCTGATTCATTCAAAAGGGCTGTAACTAATC
CTGTTACACTACCTCCATAAGGAGACAATTTCGTTTTAGATGAGTTATAATACACAACTG
AAAACTTTAATTATGAAAACCTTTCAGAAACTTACATGAATAAAAAATTCGCATAAGCTT
GA


>TTHERM_00572010(protein)
MSQLTLYGFLLCPYVQRVRFALEKIGVKYDYKEIDLFKLKQKEQAYLDINPFGKVPTIVI
NNQIVYESLPLLEFLENEFGSVFPQDNIRKTQQRIWTTYFDQNFISKMWGIFSLIKTKDV
EGSKKLANELAEILRFFTLNSKLSERIKQNPSSYFEGDTLTYADFAIIPHVKVLETNYKI
FFKSSLFEQIENQDELIQNFKTYYQNVVSSDSFKRAVTNPVTLPPQGDNFVLDELQYTTE
NFNYENLSETYMNKKFAQA