Identifiers and Description

Gene Model Identifier

TTHERM_00575360

Standard Name

GST62 (Glutathione S-transferase zeta 1, TtGSTz1, GSTz1)

Aliases

PreTt28926 | 77.m00138 | 3812.m02621

Description

GST62 glutathione S-transferase zeta; maleylacetoacetate isomerase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04003.1 1.99972299831384e-147
Description: maleylacetoacetate isomerase (221 aa)
DictyBase DDB_G0278155 4.000904604388404e-59
Description: mai on chromosome: 3 position 376116 to 376878
WormBase WBGene00001790 5.001636743996964e-56
Description: locus:gst-42 Probable maleylacetoacetate isomerase status:Confirmed UniProt:Q18938 protein_id:CAA91449.1
Oxytricha Contig3598.0.1.g92 8.002420766648515e-44
Description: Glutathione S-transferase, C-terminal domain
Stentor Coeruleus SteCoe_20224 4.780892883885469e-25
Description: None
SGD YNL229C 0.0000009995106777214876
Description: URE2 Nitrogen catabolite repression transcriptional regulator that acts by inhibition of GLN3 transcription in good nitrogen source; has glutathione peroxidase activity and can mutate to acquire GST activity; altered form creates [URE3] prion

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00575360(coding)
ATGGCTGAAAGCTCAAAGAAAATTACTCTTTACAGTTATTTCCGCTCCTCAACTTCATGG
AGAGTAAGAATAGCTCTTAATCTTAAGAAAATAGACTACAACATCATTCCTATTAACCTT
TTGAAGAGTGAATAAACTTCTGAAGAATATACTAAAATCAATCCTAACTAGGGAGTCCCT
GCTTTAAAGTATGGAGACGAGGTTATTATTGAAAGCTCTGCTATCTTAGAGTTTTTGGAA
GAAGTATTTCCTGAGCACCCACTTCTTCCTTAAGATGCAGTTAAAAGAGCTTAAATTAGA
GGCTTTTGCCAAGTAATTAACACTGCCATCCACCCTCTCTAAAATTTGAGGGTGCTTAAT
AAGATTGAAAAGGAATATAGCTAAGACAAGATTCAATGGCTCAAATTCTGGGTTACTAAG
GGTTTGACAGCAATTGAAGAATTATTAAAGAATTCTCATGGAAAATATTGCTTTGGTGAT
GAAATAACACTTGCTGACTTATTCTTGGTACCTCAAGTTCAAGGAGTTGTAGATAGATTC
CAATTTGATTTAACCCCTTTCCCCAATATTGCAGAAGTTTTAAAAAATTTAAAGGAAATT
CCTGAGTTCGTTGCTGCCTCACCCAGCAAGTAAGCTGACAATCCTGATAATCAAAAGATC
TGA


>TTHERM_00575360(gene)
ATGGCTGAAAGCTCAAAGAAAATTACTCTTTACAGTTATTTCCGCTCCTCAACTTCATGG
AGAGTAAGAATAGCTCTTAATCTTAAGAAAATAGACTACAACATCATTCCTATTAACCTT
TTGAAGAGTGAATAAACTTCTGAAGAATATACTAAAATCAATCCTAACTAGGTAATTAAT
TTAATTTTTTATGAGAGTAATTATAATTCTAAGAAATATAAAACACTATTAGGGAGTCCC
TGCTTTAAAGTATGGAGACGAGGTTATTATTGAAAGCTCTGCTATCTTAGAGTTTTTGGA
AGAAGTATTTCCTGAGCACCCACTTCTTCCTTAAGATGCAGTTAAAAGAGCTTAAATTAG
AGGCTTTTGCCAAGTAATTAACACTGCCATCCACCCTCTCTAAAATTTGAGGGTGCTTAA
TAAGATTGAAAAGGAATATAGCTAAGACAAGATTCAATGGCTCAAATTCTGGGTTACTAA
GGGTTTGACAGGTAATTAATTTTAATTCTATTATAATGAATGAGCGTTCAATAATTTAAA
AAATATATAAAGCAATTGAAGAATTATTAAAGAATTCTCATGGAAAATATTGCTTTGGTG
ATGAAATAACACTTGCTGACTTATTCTTGGTACCTCAAGTTCAAGGAGTTGTAGATAGAT
TCCAATTTGATTTAACCCCTTTCCCCAATATTGCAGAAGTTTTAAAAAATTTAAAGGAAA
TTCCTGAGTTCGTTGCTGCCTCACCCAGCAAGTAAGCTGACAATCCTGATAATCAAAAGA
TCTGA


>TTHERM_00575360(protein)
MAESSKKITLYSYFRSSTSWRVRIALNLKKIDYNIIPINLLKSEQTSEEYTKINPNQGVP
ALKYGDEVIIESSAILEFLEEVFPEHPLLPQDAVKRAQIRGFCQVINTAIHPLQNLRVLN
KIEKEYSQDKIQWLKFWVTKGLTAIEELLKNSHGKYCFGDEITLADLFLVPQVQGVVDRF
QFDLTPFPNIAEVLKNLKEIPEFVAASPSKQADNPDNQKI