Identifiers and Description

Gene Model Identifier

TTHERM_00575440

Standard Name

MRNO32 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt28934 | 77.m00146 | 3812.m02629

Description

calpain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04011.1 9.997093137033517e-262
Description: hypothetical protein (1124 aa)
Oxytricha Contig16070.0.g103 9.995317835403734e-19
Description: MORN repeat
DictyBase DDB_G0349488 0.00000000000020009182674645818
Description: DDB_G0349488 on chromosome: 2 position 6912714 to 6914186
WormBase WBGene00002179 0.0000000006999585478469937
Description: locus:jph-1 status:Confirmed UniProt:Q22667 protein_id:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00575440(coding)
ATGGAGGTTGAAAGTAAGGTGTAGAGCTAAGGGAAGGATCAAAGATATCAAAATGAAGTT
TCTTATGGAAAAAGAAAGTATGTTGGTTAGTTTTTGAATGGAAAGCGTGACGGAAAAGGC
AAAGAAGAAGATAAAACTAACCATACCTTATATGAAGGTAACTTTTAAGATGATATGTAT
CATGGTATAGGTACACTCTATCAACTATAAACAAAGTGCTATTTTAAGGGAATATTTGAA
AAAAATTAGAAGAAAGCAGGCATTGAAATCTTTCCAAACGGTGATGTTTATGAAGGTGAG
TACAAAGATGATTAATTCCATGGTAAAGGATATCTCAGAAATAGAGATTTATTCTATTTT
ATAGATGATGGTAAATCTTCTTAGTAGGTTAACGATTAAAAAAAAGTTTAATCAACATAC
TCTTATGAAGGCACCTTTTAGAATGGTAAAAAAGATGGTTTCGGCACTGAAAGGTATATT
AAAGGCGCTGTTTATGTAGGTGAATTTAGAAATAATTAAAAACATGGTAAAGGCAAGCTT
TAGTATCCAGATGGTAGCTATTATGAAGGAGACTTTGTGAATGGTGTTCCCTGTGGGTTT
GGTGTTCATTGTGCCTACTCAGTAGAATAGATATAAAGCATAAAACCAATTAAAAAAGGA
GCCACAAATAATAGCAAAGCAAATGAAAGGTTATAAAGAAATATTTAATTGAAGGAATCC
TTAGCAATTAATAGTTTGCAAGATATTGATAGCAGCTAACAATTAATCCAAAAGGAAGAT
GAAAAAGAAAACTATTAAATGAGCTATTTTGATGAAAAACCTGAATTTTACTATGAAGGT
GAGTTTATGGAAGGTTTTAAGCATGGAAAGGGAAGGTTTTATTTTCCAGACGGTTCGTAT
TATTATTGCCAGTGGGCTTTCAATAAAAAAGTAAAAGATATAATCTATTACGATGCTCCA
GCTAATAAGCACTGCATATTTACTTATGTAAATATAGAAAAAGTTATTAATCATTTCCAT
AAACCTATTTAATAAGATCCTAATATTGTTGGTAGTGAAATGATATTAGGATATCCTCCA
AACGATCAAGATGGCTATAAGTAAATCATTGATAGCTGTGGGATAAATGGTGATTAATTT
GAAGACGATGAATTTAAATCAAATGAGTAAAATATGAGTTTCCCTGATTCTGGAAGTAGC
AAAAGGGCTAATTTAGATATAGAATTTTTAAAACTTAAAGATAATCATCATTTTTATGAT
GAAGGAAAAGATCTTTTTGAATTCCCTATTTAGTCAAATACTATAGTTTACAATTAATTG
TCAGATTATCAATTGGTTACATGTATTGAAGCTCTATCTTACTTTCCTCACATCTTTTTC
AAAATATTTTCAGTCAGATACGATTTAGCTGACATAGGATTTGTTTTTATTAAGCTCTAT
ATTAATGGCGAATGGAGAGATATTATACTTGATGATATTTTTCCTTTTTATGATTCTTAA
TAAGATGTAATTTTTTCAACTACAGTTCTGAAAGAATTGGGATATTTATTTCTTCAGAAA
GCTTTCTGTAAAATCTAGAATTCTTTCTTTGGACACAAGTAAGACACAGAAACGATAAAA
GCCGAGGATTATTTCTAAATGCTTTCTGGTCTTCCGTGCAAGAGCATAACTTGGGAAAAT
GATTTAGATGAAGACTAGAAATTAAATGTAAAAAAATTAGTAGAATGTAGCTCTAAAAGC
TGCAAAGTAGCTTACTTATAAGAGAAATTCAGCCGCAGTAGAGATATAGATATTCCAAAA
AATTATCCTTACATCATTTTAGAAGTTGTAGATTTGGGAGTCTAATAGCAATAATTCTAA
CCAAACCACACTTTAACCAATTTAAATAGTTTGAATGCACCCACAAATGAAAACTTATTT
ATAATATTAAAATCAATTGATTCTAATTTTAGCTTTATTAAAAGAAGATGTGAAGAGAAG
ATTTCTTTCTCTAAACACAATTAAATACTTAAAGATATCATTTAAAGGCATACAATTATT
CCTGATGATTTCATGAATTAATATACAAGTTTAAAGGAAAGTAACAATCCAATTAATAAA
AATAAAATATACGAATTCGAAGAATACTTTAAAAAAATTAAATAATCTGTATTTGCTCTA
GATTTTGAAACTTTTATCGAATGCTTTGGAAGCGTTTATTAATTGATTGGAGTTAACCAA
AACTTTTAGAGCTCAAGCTTTGTATAAGAAAATATTGGAACTTAACTGGTGGAATCGAGA
TATTTCTTTTCATTTAATTTGAACTTACCAGCTAGAATTTTAATAAATGTCGAGCAATAT
TTATAGGGAATTAGCTAACATTTACCTGTCAGAATACTATTAGCTTAAGACAAAATGGGA
GTATATGCATAGAGAACTAAATAATCTCATACAGACGATGGAAATGACTATGTAGCTAGA
AACAAAAAAGATACAATTTGTGAAGAAAGTTAAAGCAAAAAAAGAAACAGATTTAATTAA
TAGAGAAAAAGCTAAGATGAGGATTAGCATAATTCCCAACATGAATCAAGAATTTACTAA
AAAAAGAAGTTCCACAGCCTAAAATATATAATTGGAAAAGGGCAGTATAAAAAGAAAAAT
GTCTTTAAAACAGTTGTTTTAGATGAAGGAACTTATATACTAATGGTTCAAGTTGAAGGA
CCTGACCTTAAGAGTTTACAGGATCTAAAAGAAAATGTTAAGGAATTTAATTTAAAATTA
GTTGTTAATATATTTGGAGATAATCTTCTGAATATTTTACAAATCGAGCATCCAGAAAAT
TTTATGCGCCAGGTTTACGAATCGTGTATCCATAATGCAGAAAAGAAATACCTTGAGAAT
TAGTAAAAGTAGTTAAAAGACTAAGTTCAAGATATTAGATTCTAAAGATCAGATTTGGGT
GACAGAGAAAATGGTAGTGACTAAATTATTATTTGCTAATTCTACCTTTAATAAGAAGGA
ACTTACTTATAACTACTTGATAATAGAACAGATAACAAAAGTTGGAGACAAAAATTGTAC
TTTATTACTGAAAACATGAAGATAGTAGATTCAAATGATAATAAGGTTGATGTCTATTTA
GGTCCACACTAAGATGCACTTATTATTATTTAATAAGTAAGAGGAGGTGTATATCGCTTA
GAAGGTGGAGAGGGTATATGTTTAATAGAAAATATTCAAAAAAATATAGATTCAGACGAT
AACGATGAATTAGATGATAATTGA


>TTHERM_00575440(gene)
ATGGAGGTTGAAAGTAAGGTGTAGAGCTAAGGGAAGGATCAAAGATATCAAAATGAAGTT
TCTTATGGAAAAAGAAAGTATGTTGGTTAGTTTTTGAATGGAAAGCGTGACGGAAAAGGC
AAAGAAGAAGATAAAACTAGTAAATTGATAAATCATTAATTTAGTTAAAACATCAACAAA
TTATTAAAATAAATAAAAGACCATACCTTATATGAAGGTAACTTTTAAGATGATATGTAT
CATGGTATAGGTACACTCTATCAACTATAAACAAAGTGCTATTTTAAGGGAATATTTGAA
AAAAATTAGAAGAAAGCAGGCATTGAAATCTTTCCAAACGGTGATGTTTATGAAGGTGAG
TACAAAGATGATTAATTCCATGGTAAAGGATATCTCAGAAATAGAGATTTATTCTATTTT
ATAGATGATGGTAAATCTTCTTAGTAGGTTAACGATTAAAAAAAAGTTTAATCAACATAC
TCTTATGAAGGTAATTAATTCATTTATTTGTGTTTAGTTGATTACTTTAAAATAAATTTG
AGTCATTTATAATTAACTAATTAATTTAATTGAGAATATGAAATACTAATAATATAATTT
TAGGCACCTTTTAGAATGGTAAAAAAGATGGTTTCGGCACTGAAAGGTATATTAAAGGCG
CTGTTTATGTAGGTGAATTTAGAAATAATTAAAAACATGGTAAAGGCAAGCTTTAGTATC
CAGATGGTAGCTATTATGAAGGAGACTTTGTGAATGGTAATTTAACAAATTAGGTTTATT
ATAATAAATAAATTATTTTTTGAGAGAAAAATCAAATGTTGGAAAGATTGATTTCAATAA
TTAGCTAATTAATTCATTATCAAGCTATAAATTAAGAAAAAAGGAGACTATGCATGATAA
TAACTTTTCATTTATTTAATAATTAAATAGGTGTTCCCTGTGGGTTTGGTGTTCATTGTG
CCTACTCAGTAGAATAGATATAAAGCATAAAACCAATTAAAAAAGGAGCCACAAATAATA
GCAAAGCAAATGAAAGGTTATAAAGAAATATTTAATTGAAGGAATCCTTAGCAATTAATA
GTTTGCAAGATATTGATAGCAGCTAACAATTAATCCAAAAGGAAGATGAAAAAGAAAACT
ATTAAATGAGCTATTTTGATGAAAAACCTGAATTTTACTATGAAGGTGAGTTTATGGAAG
GTTTTAAGCATGGTAATATTATTTTTTAATTAGCCAGCAACAATAAATAAATGATTTATA
TTCCTAACTAAATATGAAGGAAAGGGAAGGTTTTATTTTCCAGACGGTTCGTATTATTAT
TGCCAGTGGGCTTTCAATAAAAAAGTAAAAGATATAATCTATTACGATGCTCCAGCTAAT
AAGCACTGCATATTTACTTATGTAAATATAGAAAAAGTTATTAATCATTTCCATAAACCT
ATTTAATAAGATCCTAATATTGTTGGTAGTGAAATGATATTAGGATATCCTCCAAACGAT
CAAGGTTATAAATAAATAAATAAATTAAATACTTTTAAGCATATTATAAAAATATTTTTA
ATGATTAATTTTTAAAAAAATAGATGGCTATAAGTAAATCATTGATAGCTGTGGGATAAA
TGGTGATTAATTTGAAGACGATGAATTTAAATCAAATGAGTAAAATATGAGTTTCCCTGA
TTCTGGAAGTAGCAAAAGGGCTAATTTAGATATAGAATTTTTAAAACTTAAAGATAATCA
TCATTTTTATGATGAAGGAAAAGATCTTTTTGAATTCCCTATTTAGTCAAATACTATAGT
TTACAATTAATTGTCAGATTATCAATTGGTTACATGTATTGAAGCTCTATCTTACTTTCC
TCACATCTTTTTCAAAATATTTTCAGTCAGATACGATTTAGCTGAGTAAATAAATATATT
TTCATATAAAATACATTTTTAATTTGTGTAGAATTTTTCTTGTATCAATTAATTATCTTT
TATAATAAATTAATTAATAGCATAGGATTTGTTTTTATTAAGCTCTATATTAATGGCGAA
TGGAGAGATATTATACTTGATGATATTTTTCCTTTTTATGATTCTTAATAAGATGTAATT
TTTTCAACTACAGTTCTGAAAGAATTGGGATATTTATTTCTTCAGAAAGGTAAAAATAAT
TAAATTTACTAATTGAGTGAATATTTTATTAAATATATTTTGATATGAAAAGCTTTCTGT
AAAATCTAGAATTCTTTCTTTGGACACAAGTAAGACACAGAAACGATAAAAGCCGAGGAT
TATTTCTAAATGCTTTCTGGTCTTCCGTGCAAGAGCATAACTTGGGAAAATGATTTAGAT
GAAGACTAGAAATTAAATGTAAAAAAATTAGTAGAATGTAGCTCTAAAAGCTGCAAAGTA
GCTTACTTATAAGAGAAATTCAGCCGCAGTAGAGATATAGATATTCCAAAAAATTATCCT
TACATCATTTTAGAAGTTGTAGATTTGGGAGTCTAATAGCAATAATTCTAACCAAACCAC
ACTTTAACCAATTTAAATAGTTTGAATGCACCCACAAATGAAAACTTATTTATAATATTA
AAATCAATTGATTCTAATTTTAGCTTTATTAAAAGAAGATGTGAAGAGAAGATTTCTTTC
TCTAAACACAATTAAATACTTAAAGATATCATTTAAAGGCATACAATTATTCCTGATGAT
TTCATGAATTAATATACAAGTTTAAAGGAAAGTAACAATCCAATTAATAAAAATAAAATA
TACGAATTCGAAGAATACTTTAAAAAAATTAAATAATCTGTATTTGCTCTAGGTAAAAAA
TTTTTTTTTTTTGAAAATCCTCTTTAAAAGAGAAATTATTTGAAAGAACAATTTATAATA
TTTTTAATTTAATCTGATAAAAAATTTAAATTATTTCATAATAAATAATAAGATTTTGAA
ACTTTTATCGAATGCTTTGGAAGCGTTTATTAATTGATTGGAGTTAACCAAAACTTTTAG
AGCTCAAGCTTTGTATAAGAAAATATTGGAACTTAACTGGTGGAATCGAGATATTTCTTT
TCATTTAATTTGAACTTACCAGCTAGAATTTTAATAAATGTCGAGCAATATTTATAGGGA
ATTAGCTAACATTTACCTGTCAGAATACTATTAGCTTAAGACAAAATGGGAGTATATGCA
TAGAGAACTAAATAATCTCATACAGACGATGGAAATGACTATGTAGCTAGAAACAAAAAA
GATGTAAAAATTAACATTAACTCTCAGTTAAACATATTTTTTTAGTTTTTAAAAAGACAA
TTTGTGAAGAAAGTTAAAGCAAAAAAAGAAACAGATTTAATTAATAGAGAAAAAGCTAGT
AAATTAGGAAGAGATAAATCTTTTTCAAAAGACTAAGATTTGGTACTCAGCTAATAAAGG
AGTTCAAAGAAGTATTTTTAAATTGCCATTTATTTTAGATTTGATTGAAATATATATTAA
TTTAATAGAGATGAGGATTAGCATAATTCCCAACATGAATCAAGAATTTACTAAAAAAAG
AAGTTCCACAGCCTAAAATATATAATTGGAAAAGGGCAGTATAAAAAGAAAAATGTCTTT
AAAACAGTTGTTTTAGATGAAGGTAATTAACTAATTAAATTATAATTAATATAACTAGAA
AATTTCATTTTTATGAAAATGAATATAAATTTAATAAAAATTGAAACTTTTTGATATTTT
TTATTCGATTTCCATTCATTTTTACGATATAAAAATTTTTATTCTCACAAAATTAGTTAC
ATGTAACTAATTAAAAGAATCTGTGCTAATTTTCTCATATTAGATATTTATATATCTTAC
ATATTAGATTTTTAAAATGTAGAAATTGATAAATATTTAATTTAGCTTTTCCTCATTTAT
CTAAGTAAAATAATATTGATATTTTCGATATTTAGGGTATTTTTATTTTATTTTTAAAAT
ATTGATATCTGCTTATATAATAAAAGCTAAATATCGGACAACTATAGTAAATATAAAGAA
ATATTTATATATCTAAATATGTTAAATAAAATACTAATTTACAAAATTAAAGATTTAATC
TTTTTTATTTAAAAAAAAGGAACTTATATACTAATGGTTCAAGTTGAAGGACCTGACCTT
AAGAGTTTACAGGATCTAAAAGAAAATGTTAAGGAATTTAATTTAAAATTAGTTGTTAAT
ATATTTGGAGATAATCTTCTGAATATTTTACAAATCGAGCATCCAGAAAATTTTATGCGC
CAGGTTTACGAATCGTGTATCCATAATGCAGAAAAGAAATACCTTGAGAATTAGTAAAAG
TAGTTAAAAGACTAAGTTCAAGATATTAGATTCTAAAGATCAGATTTGGGTGACAGAGAA
AATGGTAGTGACTAAATTATTATTTGCTAATTCTACCTTTAATAAGAAGGAACTTACTTA
TAACTACTTGATAATAGAACAGATAACAAAAGTTGGAGACAAAAATTGTACTTTATTACT
GAAAACATGAAGATAGTAGATTCAAATGATAATAAGGCAAAATATTTTTTTTGATAATAT
TTCTTTATCAAATTTTTAAAGATATTATTAAAGTTATTAAGATATTTTATCCAACATAAA
TTCAATATTATACCATACATGCATTTTAATAATTAATAAAATATTGTATAAAATAGGTTG
ATGTCTATTTAGGTCCACACTAAGATGCACTTATTATTATTTAATAAGTAAGAGGAGGTG
TATATCGCTTAGAAGGTGGAGAGGGTATATGTTTAATAGAAAATATTCAAAAAAATATAG
ATTCAGACGATAACGATGAATTAGATGATAATTGA


>TTHERM_00575440(protein)
MEVESKVQSQGKDQRYQNEVSYGKRKYVGQFLNGKRDGKGKEEDKTNHTLYEGNFQDDMY
HGIGTLYQLQTKCYFKGIFEKNQKKAGIEIFPNGDVYEGEYKDDQFHGKGYLRNRDLFYF
IDDGKSSQQVNDQKKVQSTYSYEGTFQNGKKDGFGTERYIKGAVYVGEFRNNQKHGKGKL
QYPDGSYYEGDFVNGVPCGFGVHCAYSVEQIQSIKPIKKGATNNSKANERLQRNIQLKES
LAINSLQDIDSSQQLIQKEDEKENYQMSYFDEKPEFYYEGEFMEGFKHGKGRFYFPDGSY
YYCQWAFNKKVKDIIYYDAPANKHCIFTYVNIEKVINHFHKPIQQDPNIVGSEMILGYPP
NDQDGYKQIIDSCGINGDQFEDDEFKSNEQNMSFPDSGSSKRANLDIEFLKLKDNHHFYD
EGKDLFEFPIQSNTIVYNQLSDYQLVTCIEALSYFPHIFFKIFSVRYDLADIGFVFIKLY
INGEWRDIILDDIFPFYDSQQDVIFSTTVLKELGYLFLQKAFCKIQNSFFGHKQDTETIK
AEDYFQMLSGLPCKSITWENDLDEDQKLNVKKLVECSSKSCKVAYLQEKFSRSRDIDIPK
NYPYIILEVVDLGVQQQQFQPNHTLTNLNSLNAPTNENLFIILKSIDSNFSFIKRRCEEK
ISFSKHNQILKDIIQRHTIIPDDFMNQYTSLKESNNPINKNKIYEFEEYFKKIKQSVFAL
DFETFIECFGSVYQLIGVNQNFQSSSFVQENIGTQLVESRYFFSFNLNLPARILINVEQY
LQGISQHLPVRILLAQDKMGVYAQRTKQSHTDDGNDYVARNKKDTICEESQSKKRNRFNQ
QRKSQDEDQHNSQHESRIYQKKKFHSLKYIIGKGQYKKKNVFKTVVLDEGTYILMVQVEG
PDLKSLQDLKENVKEFNLKLVVNIFGDNLLNILQIEHPENFMRQVYESCIHNAEKKYLEN
QQKQLKDQVQDIRFQRSDLGDRENGSDQIIICQFYLQQEGTYLQLLDNRTDNKSWRQKLY
FITENMKIVDSNDNKVDVYLGPHQDALIIIQQVRGGVYRLEGGEGICLIENIQKNIDSDD
NDELDDN