Identifiers and Description

Gene Model Identifier

TTHERM_00575490

Standard Name

RABX29 (Rab-like)

Aliases

PreTt28939 | 77.m00151 | 3812.m02634

Description

RABX29 Ras family small GTPase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04017.1 5.001636743996964e-56
Description: hypothetical protein (217 aa)
Oxytricha Contig17842.0.g110 0.00000000002000577768187062
Description: Ras family
SGD YFL038C 0.0000000020002373268528243
Description: YPT1 Rab family GTPase, involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by protein geranylgeranyltransferase type II (Bet2p-Bet4p)
DictyBase DDB_G0269238 0.00000008001913847069386
Description: rab11A on chromosome: 1 position 4269122 to 4270264
WormBase WBGene00004266 0.00000019998969434520019
Description: locus:rab-1 status:Confirmed UniProt:Q9UAQ6 protein_id:CCD67094.1
Stentor Coeruleus SteCoe_4991 0.000045399929762484854
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00575490(coding)
ATGAACTTTAATCTTTGTGCAGCATTTAAAAAGTGCTCTGAACCTTCTAATAAAAGGAGA
ATGTAAAAAAAGACTTTTGATGCTACTGCTATGATGATTGGGGAATCCAAAGTTGGCAAA
AGCTCTATCCTAGATGCTATCAATAATTAAAATTTTAATCCAAGCTATAGAAGAAGTCAA
AATTACGATTACTAAAACTTCAAGTTGGATGACGAAGGTACTAAGACAGTATATAATTTC
AAGGTTTGGGAGGTTAATTGTGTCTTCCATCTGATCAACTTAAAATCAGCTAAAATCTTA
TTTTATGTTTTTGCTTTCGATGACTTAGAGAGCTTCAACTCAATTTGCAAGTATAGATAA
ATGCAAACATTTTCTAGTCCTCTTGAGCAAACATTTATATAGAAACCGATTGAATTTATG
GTTGGGAACAAATCAGACATATAAGATAAAGCCGTAGATTCAAAAGTAGCCTAGGAATAC
TCATTGAAACATGATATGATATACATAGAAACATCATGTTTAAATATGGAGAGCATCAAA
AACTTAATAGGCGAAACGATTTAAAACTTAAATAATATGACATAAATCTAGCATAGCAGC
AACTCTTAAAACAAAACAAAGATTACAAGTAAATTATAACAAGACTGA


>TTHERM_00575490(gene)
ATGAACTTTAATCTTTGTGCAGCATTTAAAAAGTGCTCTGAACCTTCTAATAAAAGGAGA
ATGTAAAAAAAGACTTTTGATGCTACTGCTATGATGATTGGGGAATCCAAAGTTGGCAAA
AGCTCTATCCTAGATGCTATCAATAATTAAAATTTTAATCCAAGCTATAGAAGAAGTCAA
AATTACGATTACTAAAACTTCAAGTTGGATGACGAAGGTACTAAGACAGTATATAATTTC
AAGGTTTGGGAGGTTAATTGTGTCTTCCATCTGATCAACTTAAAATCAGCTAAAATCTTA
TTTTATGTTTTTGCTTTCGATGACTTAGAGAGCTTCAACTCAATTTGCAAGTATAGATAA
ATGCAAACATTTTCTAGTCCTCTTGAGCAAACATTTATATAGAAACCGATTGAATTTATG
GTTGGGAACAAATCAGACATATAAGATAAAGCCGTAGATTCAAAAGTAGCCTAGGAATAC
TCATTGAAACATGATATGATATACATAGAAACATCATGTTTAAATATGGAGAGCATCAAA
AACTTAATAGGCGAAACGATTTAAAACTTAAATAATATGACATAAATCTAGCATAGCAGC
AACTCTTAAAACAAAACAAAGATTACAAGTAAATTATAACAAGACTGA


>TTHERM_00575490(protein)
MNFNLCAAFKKCSEPSNKRRMQKKTFDATAMMIGESKVGKSSILDAINNQNFNPSYRRSQ
NYDYQNFKLDDEGTKTVYNFKVWEVNCVFHLINLKSAKILFYVFAFDDLESFNSICKYRQ
MQTFSSPLEQTFIQKPIEFMVGNKSDIQDKAVDSKVAQEYSLKHDMIYIETSCLNMESIK
NLIGETIQNLNNMTQIQHSSNSQNKTKITSKLQQD