Identifiers and Description

Gene Model Identifier

TTHERM_00576780

Standard Name

CDK11 (Cyclin-Dependent Kinase 11)

Aliases

PreTt28969 | 77.m00181 | 3812.m02656

Description

cyclin-dependent kinase-like Serine/Threonine kinase family protein; Protein Kinase family protein; involved in meiosis I completion

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04037.1 9.997093137033517e-262
Description: hypothetical protein (583 aa)
Oxytricha Contig15886.0.g14 6.000667945664035e-116
Description: Protein kinase domain
DictyBase DDB_G0268078 4.997910161537908e-106
Description: DDB_G0268078 on chromosome: 1 position 1417972 to 1419590
WormBase WBGene00001121 1.0002646133906571e-103
Description: locus:dyf-5 status:Confirmed UniProt:B3WFY8 protein_id:CAQ76489.2
SGD YBR160W 1.0000099287337047e-53
Description: CDC28 Catalytic subunit of the main cell cycle cyclin-dependent kinase (CDK); alternately associates with G1 cyclins (CLNs) and G2/M cyclins (CLBs) which direct the CDK to specific substrates
Stentor Coeruleus SteCoe_22820 5.665668176358939e-52
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00576780(coding)
ATGGACAAGTACTAATTGGTTAAAAATCTTGGAGATGGCACCTATGGAACAGTATTCAAG
GCTATCAATAAAGAAAATGGTGAAATTGTTGCTATCAAAAAAATGAAAAGAAAGTATAGA
AATTGGGACGAGTGCATGTCTCTGAGGGAAGTTAAATCGTTACGTAAAATGAATCACCCA
AATCTTGTCAAGCTAAAAGAAGTCCTCTAGATAAAAGACGAGCTTATGCTTGTTTTTGAG
TATGTAGATCTCAATTTATACTAAATGTACATGACTTACAAAGAGAAGAAAACTTAAATT
CCTGAGTCTGTTATAAAAAAAATAATTTATCAAATAGCGTTAGGCTTGGATTCACTGCAT
AACACAGGATACTTTCATAGGGATCTTAAGCCTGAAAATCTATTGGTTAACATGTCATCA
TTAAACGTAAAAGTTTGCGACTTTGGACTTGCAAGGGAGGTTAGATGCCGTCCTCCTTTT
ACTGAATACGTCTCTACTAGATGGTACAGAGCACCAGAAATACTTTTACATAGCTAGAAT
TATAATTCTCCGATTGATGTATTTGCTTTAGGGTGCATTATGGCGGAATTATATAATCTT
CAGCCATTATTTTCAGGTTAAAATGAAGTAGATTAATTTTATAAAATAGTAAGTGTATTA
GGCACACCTTAAAATTGGAATGAAGGAGCTAAATTAGCCCAAAAACTGTAGTTAACAATA
CCTAAAAAGGAGCCATTGCCTTTACCATAAGTAGTGCCTAGAGCTTCTCTTGATGCACTT
TAACTTCTAGGTGATATGCTGCAATATGATCCAATGAAACGTCCTACAGCAATTTAAATT
ACAAAATATCCTTATTTTGATGATATAAGAAAAGAAAATTCAGATAGTGGAAGCTAAGTT
TTTAGTCATTCTAACCTGCAAGAAGCACACTCAGGAAATGCATTAACTTAACAAAAATCT
AATCACACATTAAGCATTACAAATATTCCTAATAAAGTTAGCGAGAATGCTTATAAAGAA
ATAAAGAATCCATGGTTTGTAAACAATTAGTAATCATATTAATAACAGTAATCAGTTTTA
AATGAAAATAATTTTGCTAAAAAGTAAAATACCCAATCATATCAAAGCTTCAATACTCTT
AATTTAAGTAAGCCTTAAAATCCTTTCTAACAGTATAAAGATGAATTTTTAAAAAACTAA
AATATCTACTCTAAACAGCATGTATAAGATTCTAATTATGCTAAGAGAGCTGCAAATTAA
TTATTATATGAGTAGTAGTAATCATAGTAAAACCTTAATCCTGCTTCAACTACTAACTAC
CATTTTGCAAGTAAGTCGAATTTAAATGGAGCTTAGAACTCTGGATTACCGTTTGGAGGA
ACATTAGAAAGACCTCTTAATTTTAACAATTAATATGATCTTTAGAAAGTGAACAGAAGA
TAAAATAATTTGCTGAAAAAGAATTATGAGAATTTTAACTCTATTCAATCTAACAATGAA
CCATAATATTTCAATCAACAAAAATATAGTGATTTATAGAGCTCATTAGACAATCAAGCA
GCAGCTTTTTTCAATTAATTTAATAAAGTTTAGGTTAGCAATAATAACTATTAAAATTAC
CATAACAATAAGAACTCTTCTTTGCCACCAGAATATAGAAATGTCAATAATGAAGCTGAA
TCTTAATAACTGAATAAAATGTTTGAAGATAAGCTAAATTGGGCATTTTGA


>TTHERM_00576780(gene)
ATGGACAAGTACTAATTGGTTAAAAATCTTGGAGATGGCACCTATGGAACAGTATTCAAG
GCTATCAATAAAGAAAATGGTGAAATTGTTGCTATCAAAAAAATGAAAAGAAAGTATAGA
AATTGGGACGAGTGCATGTCTCTGAGGGAAGTTAAATCGTTACGTAAAATGAATCACCCA
AATCTTGTCAAGCTAAAAGAAGTCCTCTAGATAAAAGACGAGCTTATGCTTGTTTTTGAG
TATGTAGATCTCAATTTATACTAAATGTACATGACTTACAAAGAGAAGAAAACTTAAATT
CCTGAGTCTGTTATAAAAAAAATAATTTATCAAATAGCGTTAGGCTTGGATTCACTGCAT
AACACAGGATACTTTCATAGGGATCTTAAGCCTGAAAATCTATTGGTTAACATGTCATCA
TTAAACGTAAAAGTTTGCGACTTTGGACTTGCAAGGGAGGTAAGAGATAATTATATATAA
CAAATAGAATAAATAAGCTAAACACCCTTAACTATAAATTTCACCAGTTTTATAAAAATT
TAAAGCTGCTGATTTTCACTTCTTTGAAATCCTAAAAATGGCTTAAATAATAAAGAAAAG
TAGCTTACTAAAATGAATAAAACATGTGAACACAAATAAATATTTAAATCCCTCTTAAAA
ATTCTAAATTTTTTGTTATGTTTTAAACTAACGTTCAATTTTTTTTTTTTCGCGACGAAT
TTATTCCAGTCTTCTAATTTGTTCGAATATACAATGATGCGCGATATTATTTTTATTAAT
ATCAAGTAAATGAAGCCTTACAGTAATACTTACAAGAACTTATATTTTTGTAAATTATTT
TTTCCAGTACTTGAAGAGGATAAAAATTATCAATAATAATGCTCTTTCAAGCATTGATAG
CATATTTTTTATTCCTCAATTCAATATTTTGTTTAATTGTCGTAATTCATATCCTTGCTG
GTTCTACTACCTATAAAACTCCCATCATTTTTAAAATTAGAATCATTCATTTGAAAGCTC
TTAATATTTTTAAAAGAAAGAGGATTTATTTAAATATATCAATCCTTAAATGATATTTTA
AATAAAGACTCTAATTTATAATGAATTATAAAAATACTTTGATTACTACCATAAATTTAT
TCAAATACTTTTTGTTACATCTGGATTAATGATTCTCTTTTGTGGTCAAAATTAATTCAT
AGTGTTTTATTTTTAAATATTTATTAAACAAAATTGTAATTTTGACCATAGAATTAATCC
CAATTTTTTAATTTATTTATTTTATAATTAATATTATTGCAGGTTAGATGCCGTCCTCCT
TTTACTGAATACGTCTCTACTAGATGGTACAGAGCACCAGAAATACTTTTACATAGCTAG
AATTATAATTCTCCGATTGATGTATTTGCTTTAGGGTGCATTATGGCGGAATTATATAAT
CTTCAGCCATTATTTTCAGGTTAAAATGAAGTAGATTAATTTTATAAAATAGTAAGTGTA
TTAGGCACACCTTAAAATTGGAATGAAGGAGCTAAATTAGCCCAAAAACTGTAGTTAACA
ATACCTAAAAAGGAGCCATTGCCTTTACCATAAGTAGTGCCTAGAGCTTCTCTTGATGCA
CTTTAACTTCTAGGTGATATGCTGCAATATGATCCAATGAAACGTCCTACAGCAATTTAA
ATTACAAAATATCCTTATTTTGATGATATAAGAAAAGAAAATTCAGATAGTGGAAGCTAA
GTTTTTAGTCATTCTAACCTGCAAGAAGCACACTCAGGAAATGCATTAACTTAACAAAAA
TCTAATCACACATTAAGCATTACAAATATTCCTAATAAAGTTAGCGAGAATGCTTATAAA
GAAATAAAGAATCCATGGTTTGTAAACAATTAGTAATCATATTAATAACAGTAATCAGTT
TTAAATGAAAATAATTTTGCTAAAAAGTAAAATACCCAATCATATCAAAGCTTCAATACT
CTTAATTTAAGTAAGCCTTAAAATCCTTTCTAACAGTATAAAGATGAATTTTTAAAAAAC
TAAAATATCTACTCTAAACAGCATGTATAAGATTCTAATTATGCTAAGAGAGCTGCAAAT
TAATTATTATATGAGTAGTAGTAATCATAGTAAAACCTTAATCCTGCTTCAACTACTAAC
TACCATTTTGCAAGTAAGTCGAATTTAAATGGAGCTTAGAACTCTGGATTACCGTTTGGA
GGAACATTAGAAAGACCTCTTAATTTTAACAATTAATATGATCTTTAGAAAGTGAACAGA
AGATAAAATAATTTGCTGAAAAAGAATTATGAGAATTTTAACTCTATTCAATCTAACAAT
GAACCATAATATTTCAATCAACAAAAATATAGTGATTTATAGAGCTCATTAGACAATCAA
GCAGCAGCTTTTTTCAATTAATTTAATAAAGTTTAGGTTAGCAATAATAACTATTAAAAT
TACCATAACAATAAGAACTCTTCTTTGCCACCAGAATATAGTAATTTAATTTCTTTTTAT
TATTTTATTAATTTATTTTATTAAATAGGAAATGTCAATAATGAAGCTGAATCTTAATAA
CTGAATAAAATGTTTGAAGATAAGCTAAATTGGGCATTTTGA


>TTHERM_00576780(protein)
MDKYQLVKNLGDGTYGTVFKAINKENGEIVAIKKMKRKYRNWDECMSLREVKSLRKMNHP
NLVKLKEVLQIKDELMLVFEYVDLNLYQMYMTYKEKKTQIPESVIKKIIYQIALGLDSLH
NTGYFHRDLKPENLLVNMSSLNVKVCDFGLAREVRCRPPFTEYVSTRWYRAPEILLHSQN
YNSPIDVFALGCIMAELYNLQPLFSGQNEVDQFYKIVSVLGTPQNWNEGAKLAQKLQLTI
PKKEPLPLPQVVPRASLDALQLLGDMLQYDPMKRPTAIQITKYPYFDDIRKENSDSGSQV
FSHSNLQEAHSGNALTQQKSNHTLSITNIPNKVSENAYKEIKNPWFVNNQQSYQQQQSVL
NENNFAKKQNTQSYQSFNTLNLSKPQNPFQQYKDEFLKNQNIYSKQHVQDSNYAKRAANQ
LLYEQQQSQQNLNPASTTNYHFASKSNLNGAQNSGLPFGGTLERPLNFNNQYDLQKVNRR
QNNLLKKNYENFNSIQSNNEPQYFNQQKYSDLQSSLDNQAAAFFNQFNKVQVSNNNYQNY
HNNKNSSLPPEYRNVNNEAESQQLNKMFEDKLNWAF