Identifiers and Description

Gene Model Identifier

TTHERM_00579150

Standard Name

DRH45 (DExD/H box RNA helicase 45)

Aliases

PreTt05808 | 78.m00180 | 3733.m00075

Description

DRH45 DEAD-box helicase; ATP-dependent RNA helicase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR00161 ) conserved hypothetical protein TIGR00161

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16329.1 9.997093137033517e-262
Description: hypothetical protein (619 aa)
WormBase WBGene00016073 2.9993110246221282e-28
Description: status:Confirmed UniProt:O17157 protein_id:CCD62828.1
SGD YLR276C 9.998720540547892e-23
Description: DBP9 ATP-dependent RNA helicase of the DEAD-box family involved in biogenesis of the 60S ribosomal subunit
Oxytricha Contig12468.0.g66 2.99851380290819e-19
Description: DEAD/DEAH box helicase
DictyBase DDB_G0280407 4.0002685161515803e-16
Description: ddx56 on chromosome: 3 position 3312082 to 3314385
Stentor Coeruleus SteCoe_8041 0.0000022603294069810542
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00579150(coding)
ATGGATATCACAGGTCGTTTAAATTAAGAAGTTTAGATTTAAGAATTACTAGAAGGCTGC
GATGAGAATTTAATAAAAGGTCTTGTCAAAAATAAAATAGTTCATCCCACTTTTTGTCAA
GAATAGTTGTTTAATCTCAATAAGGAGAGAGATCACATTGTCATTAGAAGTGGTATGGTT
TCTGGTAAAACAACCGGTTTGCTCATAGTCCTTCTCAATGATTTCATAAATAAAATGAAG
CAGTTTAAATTCGTTGAAGGAAATGAAACTGAAGATGAATCAGTTGGTTTATTCTCAGTC
CTCATCACTGCTTCTAAAGACTTAGCTTAAAAGAATCACAGTGTAGCTGAAAACATATGC
GCCTTCATCAAAAAGCCATACAACATGCAAGTTATGAATTTAAGCACATTCTCTGAAGAA
AATTTCACAATTATACCTAAAACTCACTACTTGATTGTTGCCACACCTTCTACTTTCTTG
AAATTTGCCAAGCATACTAAATTCGATAAAAAGAAATTCGTTAACTTTGCCTTTGATGAT
ATTGATTATATGCTTTCTTTTGGCTACAAAGGCGAATTAACCAACTTCTAATTTTTCTAT
GAATCTGAAATCAAGCAAGAAAACTTTAAGTGTTACTGGAGTGCAACAGAAGAATTAAAT
GATGATTTAAAGGAATTAAAAAAGACTTTCTTGCATAAAAGTGTTATAATTAATGTAGAT
GATGATTATGATGAAATGGATGATTAAGAAAGAAAGAGCAAGCAAGCTCTTTAGTTTGAT
CACGATTAAATTACTCATTACTATACAACAGGAGATGAAACAACTCAATATATAATCTTA
TACGTCTTATTCAAGTTACGTTTCCTTTAAGGAAAATCTTTAATCCTCTGTAGCGACCTA
GAAACTGTATACAAGGTTCATTTATATTTAGAAAGAATTGGTTAAACAGAAATGCAGTTA
TATAATCATGAAAATCCCAAAAATTTACGTTACTATATTGTAACACTTTTCAACACTGGT
ATGATTAAAACATTGGTTTCCACCAAGTAGTTGTTCTAGGATTTCAAGAATAAAGACTTT
TATGATAAAAAAATAAAAACAAACAGACTTAAGGGTATTAGAAATATTATAAATTTAGAT
TTACTTGATATTGGAGAGGAATATAATTAATTCTTCAAGCTCTTCAACGGTTAGACAGGA
AATATTTTCAACTTAGTCTTAAACGAAGAAAAGCAAATTGAAAACTTGATGAATCGTATT
GAATATGAAAAAGAAAATTTCAACAAAGTTAATTTCAAAGAATTTCCTCTTCGTCGTCAT
GAAATTGAAGCATTTAGATATAGAGTCAACAACGTTTATACTAGCTTAACCAAAAAATAA
ATAGCAAGTGCTAAAATGCTTGATTTTAAAAAGAAAATGCTTAAATCTCCTGATATGAAA
GAATATTATGCTAAAAATATTTCAGAAAAAGAATTGTTGATTGAAAGTATATAAAAGCTT
ACCAAGTAACTCAAAAAGCACGAAACAAGATGTGAAGGCGATGTACCCGATTATCTTTTA
CCTTAGTTCTTAATAGATTAAAAGAAAAGAGCAGAAGAACTTGATCCAAATGCAAACAAG
AAGGTCAAGAAAATTTTAGTTTACAAAGGTAGCAGCGGTTCTCAATAAGCAGATGAAGGC
AAAAAGAAAATGAGAGGTGATAAATACGTTTACATTAATGAAGAAAAAGAAAATGAAAAT
GAAACAGATGCCTCCAGATTAAAAATTTTATCAAGAAAGAAATAATGGAAGCTTCGTCAT
GGTTTTAAATTAAAAAGAGTTAATAAACGTTTAGAGAAGAAAGGTATTTTCTAATCTTGA


>TTHERM_00579150(gene)
ATGGATATCACAGGTCGTTTAAATTAAGAAGTTTAGATTTAAGAATTACTAGAAGGCTGC
GATGAGAATTTAATAAAAGGTCTTGTCAAAAATAAAATAGTTCATCCCACTTTTTGTCAA
GAATAGTTGTTTAATCTCAATAAGGAGAGAGATCACATTGTCATTAGAAGTGGTATGGTT
TCTGGTAAAACAACCGGTTTGCTCATAGTCCTTCTCAATGATTTCATAAATAAAATGAAG
CAGTTTAAATTCGTTGAAGGAAATGAAACTGAAGATGAATCAGTTGGTTTATTCTCAGTC
CTCATCACTGCTTCTAAAGACTTAGCTTAAAAGAATCACAGTGTAGCTGAAAACATATGC
GCCTTCATCAAAAAGCCATACAACATGCAAGTTATGAATTTAAGCACATTCTCTGAAGAA
AATTTCACAATTATACCTAAAACTCACTACTTGATTGTTGCCACACCTTCTACTTTCTTG
AAATTTGCCAAGCATACTAAATTCGATAAAAAGAAATTCGTTAACTTTGCCTTTGATGAT
ATTGATTATATGCTTTCTTTTGGCTACAAAGGCGAATTAACCAACTTCTAATTTTTCTAT
GAATCTGAAATCAAGTAAAATAAATATATTTTCTAAACTATTTATCTTTTATTTCCTTAC
ATTAGCGATGGAATCTATTTATTTGTATCTAATTTATCGTAAGTAAAATTAAAAACTATT
TTATTATTAAACAGGCAAGAAAACTTTAAGTGTTACTGGAGTGCAACAGAAGAATTAAAT
GATGATTTAAAGGAATTAAAAAAGACTTTCTTGCATAAAAGTGTTATAATTAATGTAGAT
GATGATTATGATGAAATGGATGATTAAGAAAGAAAGAGCAAGCAAGCTCTTTAGTTTGAT
CACGATTAAATTACTCATTACTATACAACAGGAGATGAAACAACTCAATATATAATCTTA
TACGTCTTATTCAAGTTACGTTTCCTTTAAGGAAAATCTTTAATCCTCTGTAGCGACCTA
GAAACTGTATACAAGGTAATTAAATCTATCTTACATTGCTTACTTTATATTTATTTTTAA
ATCATAAAACTATTTATTTGCTCATTTATTTAAGGAATTATCTTTTAATTTTGCAAGTCT
ATAATTAAAATTAGTAAAAGCATATTGAAAAATAGAAAAATTCTATTCAAAAATAATTAA
AAACTTTTTTATTGTGAGAAATTAATTTTAAAATTTTGTTAAAATAGGTTCATTTATATT
TAGAAAGAATTGGTTAAACAGAAATGCAGTTATATAATCATGAAAATCCCAAAAATTTAC
GTTACTATATTGTAACACTTTTCAACACTGGTATGATTAAAACATTGGTTTCCACCAAGT
AGTTGTTCTAGGATTTCAAGAATAAAGACTTTTATGATAAAAAAATAAAAACAAACAGAC
TTAAGGGTATTAGAAATATTATAAATTTAGATTTACTTGATATTGGAGAGGAATATAATT
AATTCTTCAAGCTCTTCAACGGTTAGACAGGAAATATTTTCAACTTAGTCTTAAACGAAG
AAAAGCAAATTGAAAACTTGATGAATCGTATTGAATATGAAAAAGAAAATTTCAACAAAG
TTAATTTCAAAGAATTTCCTCTTCGTCGTCATGAAATTGAAGCATTTAGGTAAATATAAA
TTGCATATATTTAAAAATTAATTTAAAATTATCTTAAAAAAAATAGATATAGAGTCAACA
ACGTTTATACTAGCTTAACCAAAAAATAAATAGCAAGTGCTAAAATGCTTGATTTTAAAA
AGAAAATGCTTAAATCTCCTGATATGAAAGAATATTATGCTAAAAATATTTCAGAAAAAG
AATTGTTGATTGAAAGTATATAAAAGCTTACCAAGTAACTCAAAAAGCACGAAACAAGAT
GTGAAGGCGATGTACCCGATTATCTTTTACCTTAGTTCTTAATAGATTAAAAGAAAAGAG
CAGAAGAACTTGATCCAAATGCAAACAAGAAGGTCAAGAAAATTTTAGTTTACAAAGGTA
GCAGCGGTTCTCAATAAGCAGATGAAGGCAAAAAGAAAATGAGAGGTGATAAATACGTTT
ACATTAATGAAGAAAAAGAAAATGAAAATGAAACAGATGCCTCCAGATTAAAAATTTTAT
CAAGAAAGAAATAATGGAAGCTTCGTCATGGTTTTAAATTAAAAAGAGTTAATAAACGTT
TAGAGAAGAAAGGTATTTTCTAATCTTGA


>TTHERM_00579150(protein)
MDITGRLNQEVQIQELLEGCDENLIKGLVKNKIVHPTFCQEQLFNLNKERDHIVIRSGMV
SGKTTGLLIVLLNDFINKMKQFKFVEGNETEDESVGLFSVLITASKDLAQKNHSVAENIC
AFIKKPYNMQVMNLSTFSEENFTIIPKTHYLIVATPSTFLKFAKHTKFDKKKFVNFAFDD
IDYMLSFGYKGELTNFQFFYESEIKQENFKCYWSATEELNDDLKELKKTFLHKSVIINVD
DDYDEMDDQERKSKQALQFDHDQITHYYTTGDETTQYIILYVLFKLRFLQGKSLILCSDL
ETVYKVHLYLERIGQTEMQLYNHENPKNLRYYIVTLFNTGMIKTLVSTKQLFQDFKNKDF
YDKKIKTNRLKGIRNIINLDLLDIGEEYNQFFKLFNGQTGNIFNLVLNEEKQIENLMNRI
EYEKENFNKVNFKEFPLRRHEIEAFRYRVNNVYTSLTKKQIASAKMLDFKKKMLKSPDMK
EYYAKNISEKELLIESIQKLTKQLKKHETRCEGDVPDYLLPQFLIDQKKRAEELDPNANK
KVKKILVYKGSSGSQQADEGKKKMRGDKYVYINEEKENENETDASRLKILSRKKQWKLRH
GFKLKRVNKRLEKKGIFQS