Identifiers and Description

Gene Model Identifier

TTHERM_00582140

Standard Name

APB2 (Adaptor Protein complex 1 Beta subunit 2)

Aliases

PreTt25650 | 79.m00164 | 3827.m00880

Description

APB11 adaptin amine-terminal region protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_11859 0
Description: None
WormBase WBGene00000160 9.997093137033517e-262
Description: locus:apb-1 status:Partially_confirmed UniProt:Q7YZG8 protein_id:CCD72408.1
Tetrahymena borealis EI9_07418.1 9.997093137033517e-262
Description: adaptin N-terminal region family protein (1020 aa)
DictyBase DDB_G0279141 9.997093137033517e-262
Description: ap1b1 on chromosome: 3 position 1680228 to 1683328
Oxytricha Contig10327.0.1.g114 9.997093137033517e-262
Description: hypothetical protein
SGD YKL135C 8.997677048217667e-123
Description: APL2 Beta-adaptin, large subunit of the clathrin-associated protein (AP-1) complex; binds clathrin; involved in clathrin-dependent Golgi protein sorting

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00582140(coding)
ATGTCTTCAACTAGTTCATCAAAAAGTTCTTCTTCGAAGGGACCAGCTAATGTTAAAAAG
AATGAAATTTAGGAATTGCAAGATGATCTCATTAATAACAACGAGAATATAAAGAAGGAA
GCCGTCAGAAAAATTATTGATGCAATGACCAGAGGTAAAGATGTTTCTATGCTCTTCCCT
CACGTTTTAAGAAATATGATGACCAAGAATATGGAGTTAAAAAAATTGATATATTTATAC
ATCATTAATTATGCTAAAACAAAGCCTGATTTAGTTATTCTCGCCATCAATTCATTCAAG
AGTGATGCTTCAGATCCATCAAACCCCATGTTAAGAAGTTTAGCAGTAAGAACTATGGGT
TGTATTCGTGTTAAAGAAATTATAGAATACTTGTTGGATGCATTAAAAAAAGCAGTAAAA
GATGAAAACCCTTACGTCCGTAAGACCGCTGCAGTTTGTATAGCAAAAATCTATGAAACT
TATCCAGAATTAGTAGTTGAATAAGGTTTCTTATAGCAATTAGAATACCTTCTTAATGAT
AGCAATGCAATGGTTATTGCCAATGCAGTCTGTGCCTAAATGTAAATTTAAGATATAAAG
GGAGGAAATGTTTTGGAGCTAAATAAATTCAAAGTTTAAAAATTAAGAACTGCAATGAAC
GAATGCAACGAATGGGGTGTCATTTATATTCTTGACGCTCTTGCCGTTTACCGTCCTGAT
GACACCAAAGAGGCAGAAGATATTTTAGAAAGAGTTATTCCAAGATTGTCTCACTAAAAT
CCAGGAGTTATTTTGAGTGCTACTAGAGTTATCATGAAATATTTAGACTACTTAACTGAC
CCTGAAATGGTTATTAACTATTGCAAGAAACTAACCAGTCCTTTAATTAGTTTATTGAAT
ATGGAACCTGAAATCGTATTTATTGCTTTAAAAAATATCAATTTAATTCTATAGAAGAGA
CCTATCATTATTGAGAAGGAAATTAAATTCTTCTTCTGTAACTTTAACGATCCCATCTAC
ATCAAAGTTATGAAAATTGAAATTCTTATTCGTCTAGCTAACATTGATAATATTCCTTAA
ATTCTTCACTAATTAAAAGAATATTCAGCAGAAGTAGATATTGAAATAGCCAAAAAGTCT
ATCAGAGCTATTGGTAGATGTGCTATCAAGTTAGAAAAAGCAGCCCAAAAATGTGTTTAG
GTTTTAAGAGACTGCTTAAGATCAAAGGATGACTACGTTACTTAGGAAACTATTATAGTT
ATTAGAGATATTTTTAGAAAATATCCTAAAGATTATGAAGGTTTGTTAAAAGAAATATGC
GAAAATTTAAAGACTTTAGATAATCCTGAAGCTAAGGCTGCCATGATTTGGATTATTGGT
GAATATGTTGACACCATTGAAAACTCTGGCTCACTTCTTGAAGAATTCGTTAAGAGCTTT
ATTGAAGAACCAGCTATCGTTTAGCATTAAATTTTAACTAGTTGTGTTAAATTGTTCTTG
ATGAGACCTTAAGATGGTTACGATTTAGTCCACAAATTATTACAATAAGCCACTAACAAT
TGTGAAAATCCTGATATCAGAGATAGAGGTTATATTTATTGGAGATTGCTTGGTTAAAGC
CCTGAATTAGCTAAAAAAATTGTTTACAGTGAACGTCCTGAAATTTCAGACAATACTTAT
GTATTGGAAACAGCTCTACTTGATAAGCTTATTGAAAATATTGGAACTCTCTCCTCTGTT
TACTACAAACCTCCTGAGCAGTTCGTTAAGCACTTAAGAGATATTATTAACCAAAAAGAA
ATGGAAGAAAATGAAGCAGAAGAAGCTGGTGATGAATTCTTCATTAAGGGTGAAAATAAT
GTAGCTGATAAAGATTACTATGGTGGGGAAGTTACGATTAATGATGATCAAGCTTAATAA
TAGCAATCAAATATTTAATATAATATGAATAGCAATATTTAAAATACTTAAATGTAATTA
AACCAAAGCAATATAAGCTCTACTCCCTCAACTGCTGCTACAGTTAACTAGAGTTAGGCT
AAAAATTTATTAGATGATGACGATGATATAATGGCTCCACCAATATAATAGTAATAATAT
AATTAGCCTCCTCCTTAAGTTTATTAATAGCCACCTCAATAACAATAACTCTAACCTGCC
CCTTCTTAGGCTAAGAATCTTCTTGATGACGATGATGATATCATAGGTGGAGCTAGCACA
GCACCTTAACCTCAATAGATAAATTAAATGCAATATAATTAATCTCCCTAAGCTGTCAAT
AGTAATTAATAAGCTAGTTTCAGCAGCAACGGTTCAAATTCAAATAATAATACAGACTTC
TTTGGGGGTGGCTCTTAATTAAGAGCTCCTAACATTAAAATACCTTTTAGCGAATGTGTA
AATGAAAATAAGTTCTCGATGAAAAATATAGTGAATGGATTAAATATTGCTTGTGCCTTC
TAAAGAGAGGGTGCCTAGATGTTTTTAGAAATTTAAGTTTCAAATCGTTTTGGAAATAAC
ACTTTCTCAGATTTCGCTATTAAACTTGCTCCAAACAAATTTAAAATAAACCCAACAACT
ATTGATCTTAACAAATTAGGATAGGTTGCCCCTGGTCAAACTAGCTCATGTAAAATTGAA
ATTGATTGTAATGGCTAAATTGATAATGGACCTTTGAGCAGCCCTTTCTTAGTAAATACT
ATGATAAAAACAAACTTTGATGTTTACTAAATGGCAATTCCTTGCAGTCTTTCAGTTTTA
ATCGTACCTGGAGCTCCTCTTTAAATCTAATAATATGGAGAATTCTCCTCTAGAATGGTC
AAAAAAGCTGATAAGATTCCCATGATTATTGATAGAGATGCACTTGTAAAGAAAATGGCC
AACAATAATATCTATTTTGTAAATTCTCAAACTAATCCTTAGGGAATTGAAATGATAAAC
TTCTCATGTAAGTTAGCTAACGAAATGCCACTTTTATTAGATGTAATTATAGATAAGATA
AATGGAGCACTTAATATTTAATATCACGCTCCTCACGACACTATTTTACCTCTTTTCTAT
TAAGCTATTATGTTCGTCTTAAAGTTCTGA


>TTHERM_00582140(gene)
ATGTCTTCAACTAGTTCATCAAAAAGTTCTTCTTCGAAGGGACCAGCTAATGTTAAAAAG
AATGAAATTTAGGAATTGCAAGATGATCTCATTAATAACAACGAGAATATAAAGAAGGAA
GCCGTCAGAAAAGTAAAAAAAAATTAATAAAAAAGGGAAAAATGAGGTTTTACATTTCCA
TAGAGGAGTTTAAAAGTTAGTTGAAAAATTTATTTTAGTATCAAGATCAACCTTCAAATT
AAAAGGCTACTCTATGTTGAAATGTGGCAGCAACCAAATAAATTAATTAGCATTAAATAA
TTCAATTTTGAATATTTTTTAATTATCCTAGATTATTGATGCAATGACCAGAGGTAAAGA
TGTTTCTATGCTCTTCCCTCACGTTTTAAGAAATATGATGACCAAGAATATGGAGTTAAA
AAAATTGATATATTTATACATCATTAATTATGCTAAAACAAAGCCTGATTTAGTTATTCT
CGCCATCAATTCATTCAAGAGTGTAATTTTACATTAATTGTACAGCTAAAAAAAAGAAAT
TTTGAATTGCTTTTAGTTTTAATTACTTTGCAGACAATTAAATATATTTTTTTAGAAGGA
ATTTTCAACAATGTTAATATAAATAGGATGCTTCAGATCCATCAAACCCCATGTTAAGAA
GTTTAGCAGTAAGAACTATGGGTTGTATTCGTGTTAAAGAAATTATAGAATACTTGTTGG
ATGCATTAAAAAAAGCAGTAAAAGATGAAAACCCTTACGTCCGTAAGACCGCTGCAGTTT
GTATAGCAAAAATCTATGAAACTTATCCAGAATTAGTAGTTGAATAAGGTTTCTTATAGC
AATTAGAATACCTTCTTAATGATAGCAATGCAATGGTTATTGCCAATGCAGTCTGTGCCT
AAATGTAAATTTAAGATATAAAGGGAGGAAATGTTTTGGAGCTAAATAAATTCAAAGTTT
AAAAATTAAGAACTGCAATGAACGAATGCAACGAATGGGGTGTCATTTATATTCTTGACG
CTCTTGCCGTTTACCGTCCTGATGACACCAAAGAGGCAGAAGAGTATTTACATATTTTAA
ATCCATTCATTTGTTTTCAAATAAATAAATTAATTGAGTGAATTTTGAATCACGCATAAA
ATTTTATTTATTTCAGAACACTCTACATTTAATTTAAAATTTTTGGAGCAAATCCGACAG
CTGGTCATTTCAACATAGCATTCAGAAAGCAAAATAAAATAAGTGCATATAAATTTAATT
AAATAAAATATCTATAATTTAATCTATTTCACTATTTTAAAAGAGACTAAGATGAAAATT
ATTCTTTAAAACTTAACTATTTATTAATAGACAGTCGAAAAACTTTGATTAAATTTATTT
TAAACATTCCTGCATTCAATCAATAATTTGGAATCTCCAATCTATTTTTAAACTAGGTTT
CTGAAATAAATCTACCTTTTAACAAACAAATAAACAATCAACAATCTAAATTTATGAATA
AAGATAATAAAAATAGATAAATAAGTAAATCAAACAATATAGTTTAAATAAAAAGAATTA
AATTAGTAATAATACAAAAGCATTATTAAAATAATTAAATTTTTGATGTAAAAGTTAGAC
CTATCAATCGCTTTTATGAATTTTAAATATTAAAGCATATTTAACTTATCAATAAATGAA
TTCAATTTTATTTTTTATAATTTTACAACCTTAACAATTAAAAATTAATATTAAAATAAA
ACAGTATTTTAGAAAGAGTTATTCCAAGATTGTCTCACTAAAATCCAGGAGTTATTTTGA
GTGCTACTAGAGTTATCATGAAATATTTAGACTACTTAACTGACCCTGAAATGGTTATTA
ACTATTGCAAGAAACTAACCAGTCCTTTAATTAGTTTATTGAATATGGAACCTGAAATCG
TATTTATTGCTTTAAAAAATATCAATTTAATTCTATAGAAGAGACCTATCATTATTGAGA
AGGAAATTAAATTCTTCTTCTGTAACTTTAACGATCCCATCTACATCAAAGTTATGAAAA
TTGAAATTCTTATTCGTCTAGCTAACATTGATAATATTCCTTAAATTCTTCACTAATTAA
AAGAATATTCAGCAGAAGTAGATATTGAAATAGCCAAAAAGGTAAATTAAATAAATAAAA
AAATAGATTTTTTTCTTCATAAAATAAGAAATAAGCAAATTTATTCAAATATAAATTAAT
GAATTATATTTTATTTATTTTACTTCAATTCACTTTCAGTCTGTCTTTAAATTATTTCTT
TGAATTAACCAATAATTTTTTATAATAAATAAATTAGTCTATCAGAGCTATTGGTAGATG
TGCTATCAAGTTAGAAAAAGCAGCCCAAAAATGTGTTTAGGTTTTAAGAGACTGCTTAAG
ATCAAAGGATGACTACGTTACTTAGGAAACTATTATAGTTATTAGAGATATTTTTAGAAA
ATATCCTAAAGATTATGAAGGTTTGTTAAAAGAAATATGCGAAAATTTAAAGACTTTAGA
TAATCCTGAAGCTAAGGCTGCCATGATTTGGATTATTGGTGAATATGTTGACACCATTGA
AAACTCTGGCTCACTTCTTGAAGAATTCGTTAAGAGGTAAATAAATAAATAAAATATACC
TTCATTTTTATCAAGAAAGTTTAGATTATTAAGTAATAAAATCAATTATTTTTTTAATAT
TTAGCTTTATTGAAGAACCAGCTATCGTTTAGCATTAAATTTTAACTAGTTGTGTTAAAT
TGTTCTTGATGAGACCTTAAGATGGTTACGATTTAGTCCACAAATTATTACAATAAGCCA
CTAACAATTGTGAAAATCCTGATATCAGAGATAGAGGTTATATTTATTGGAGATTGCTTG
GTTAAAGCCCTGAATTAGCTAAAAAAATTGTTTACAGTGAACGTCCTGAAATTTCAGACA
ATACTTATGTATTGGAAACAGCTCTACTTGATAAGCTTATTGAAAATATTGGAACTCTCT
CCTCTGTTTACTACAAACCTCCTGAGCAGTTCGTTAAGCACTTAAGAGATATTATTAACC
AAAAAGAAATGGAAGAAAATGTAATTTGATTTTTAATAAAATACTCAATTATAAATTGAA
ATGGCTAATAAATATTTAAATAAACAGATTGTTGAACAAATAAATCAATTTTTATTGTTG
TATTAAATAAATATATTTTATGTAAAATTGTTAATAGGAAGCAGAAGAAGCTGGTGATGA
ATTCTTCATTAAGGGTGAAAATAATGTAGCTGATAAAGATTACTATGGTGGGGAAGTTAC
GATTAATGATGATCAAGCTTAATAATAGCAATCAAATATTTAATATAATATGAATAGCAA
TATTTAAAATACTTAAATGTAATTAAACCAAAGCAATATAAGCTCTACTCCCTCAACTGC
TGCTACAGTTAACTAGAGTTAGGCTAAAAATTTATTAGATGATGACGATGATATAATGGC
TCCACCAATATAATAGTAATAATATAATTAGCCTCCTCCTTAAGTTTATTAATAGCCACC
TCAATAACAATAACTCTAACCTGCCCCTTCTTAGGCTAAGAATCTTCTTGATGACGATGA
TGATATCATAGGTGGAGCTAGCACAGCACCTTAACCTCAATAGATAAATTAAATGCAATA
TAATTAATCTCCCTAAGCTGTCAATAGTAATTAATAAGCTAGTTTCAGCAGCAACGGTTC
AAATTCAAATAATAATACAGACTTCTTTGGGGGTGGCTCTTAATTAAGAGCTCCTAACAT
TAAAATACCTTTTAGCGTAATATTTTTTCTTTTCATAGATTGAATTTCATAACAATCAAA
TAAATAATTAGGAATGTGTAAATGAAAATAAGTTCTCGATGAAAAATATAGTGAATGGAT
TAAATATTGCTTGTGCCTTCTAAAGAGAGGGTGCCTAGATGTTTTTAGAAATTTAAGTTT
CAAATCGTTTTGGAAATAACACTTTCTCAGATTTCGCTATTAAACTTGCTCCAAACAAAT
TTAAAATAAACCCAACAACTATTGATCTTAACAAATTAGGATAGGTAATAATTTACATTT
AATTTTTTATTTTCAACGATTTTTTTTAAAGAATTATTTTATAAAAACTAATTTTTCTCT
AATTTCTTTTAATTAAATAGCAATTTTTAAAAAAAATCTAGAATTCAGAAAATATTTTTC
CAGTTTTATTTGGAATTTAAAATATGAACTGGTTTTTTATTTAAATTATTGTTAAGATTA
AACATTTTTATCATAAAAACAATACTTTATTTTTCTAAATTGAATATTTAAAATTTATTT
TCTGTAAACAAACAAACAAAGGTTGCCCCTGGTCAAACTAGCTCATGTAAAATTGAAATT
GATTGTAATGGCTAAATTGATAATGGACCTTTGAGCAGCCCTTTCTTAGTAAATACTATG
ATAAAAACAAACTTTGATGTTTACTAAATGGCAATTCCTTGCAGTCTTTCAGTTTTAATC
GTACCTGGAGCTCCTCTTTAAATCTAATAATATGGAGAATTCTCCTCTAGAATGGTCAAA
AAAGCTGATAAGATTCCCATGATTATTGATAGAGATGCAGTAATATTTTTTACATAAAAC
TCAAATTTATTAAATATATTATTGAAAAAAAAATTAAATAGCTTGTAAAGAAAATGGCCA
ACAATAATATCTATTTTGTAAATTCTCAAACTAATCCTTAGGGAATTGGTAATTTTATTA
ATAGACTGTTACAGATAATCAATTTATTTATTTATTTAAAAAACTAAGAAATGATAAACT
TCTCATGTAAGTTAGCTAACGAAATGCCACTTTTATTAGATGTAATTATAGATAAGATAA
ATGGAGCACTTAATATTTAATATCACGCTCCTCACGACACTATTTTACCTCTTTTCTATT
AAGCTATTATGTTCGTCTTAAAGTTCTGA


>TTHERM_00582140(protein)
MSSTSSSKSSSSKGPANVKKNEIQELQDDLINNNENIKKEAVRKIIDAMTRGKDVSMLFP
HVLRNMMTKNMELKKLIYLYIINYAKTKPDLVILAINSFKSDASDPSNPMLRSLAVRTMG
CIRVKEIIEYLLDALKKAVKDENPYVRKTAAVCIAKIYETYPELVVEQGFLQQLEYLLND
SNAMVIANAVCAQMQIQDIKGGNVLELNKFKVQKLRTAMNECNEWGVIYILDALAVYRPD
DTKEAEDILERVIPRLSHQNPGVILSATRVIMKYLDYLTDPEMVINYCKKLTSPLISLLN
MEPEIVFIALKNINLILQKRPIIIEKEIKFFFCNFNDPIYIKVMKIEILIRLANIDNIPQ
ILHQLKEYSAEVDIEIAKKSIRAIGRCAIKLEKAAQKCVQVLRDCLRSKDDYVTQETIIV
IRDIFRKYPKDYEGLLKEICENLKTLDNPEAKAAMIWIIGEYVDTIENSGSLLEEFVKSF
IEEPAIVQHQILTSCVKLFLMRPQDGYDLVHKLLQQATNNCENPDIRDRGYIYWRLLGQS
PELAKKIVYSERPEISDNTYVLETALLDKLIENIGTLSSVYYKPPEQFVKHLRDIINQKE
MEENEAEEAGDEFFIKGENNVADKDYYGGEVTINDDQAQQQQSNIQYNMNSNIQNTQMQL
NQSNISSTPSTAATVNQSQAKNLLDDDDDIMAPPIQQQQYNQPPPQVYQQPPQQQQLQPA
PSQAKNLLDDDDDIIGGASTAPQPQQINQMQYNQSPQAVNSNQQASFSSNGSNSNNNTDF
FGGGSQLRAPNIKIPFSECVNENKFSMKNIVNGLNIACAFQREGAQMFLEIQVSNRFGNN
TFSDFAIKLAPNKFKINPTTIDLNKLGQVAPGQTSSCKIEIDCNGQIDNGPLSSPFLVNT
MIKTNFDVYQMAIPCSLSVLIVPGAPLQIQQYGEFSSRMVKKADKIPMIIDRDALVKKMA
NNNIYFVNSQTNPQGIEMINFSCKLANEMPLLLDVIIDKINGALNIQYHAPHDTILPLFY
QAIMFVLKF