Identifiers and Description

Gene Model Identifier

TTHERM_00584840

Standard Name

SWI3

Aliases

PreTt04091 | 80.m00137 | 3675.m00035

Description

SWIRM domain protein; SANT domain containing protein. Member of the SWI/SNF complex.

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

  • negative regulation of protein kinase activity (IEA) | GO:0006469

Domains

  • ( PF00249 ) Myb-like DNA-binding domain
  • ( PF04433 ) SWIRM domain
  • ( PF04702 ) Vicilin N terminal region
  • ( TIGR01954 ) transcription termination factor NusA, C-terminal

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_15229.1 9.997093137033517e-262
Description: SWIRM domain-containing protein (1016 aa)
Oxytricha Contig17870.0.g72 2.0009381340492598e-66
Description: SWIRM domain
SGD YFR037C 6.000354955737408e-39
Description: RSC8 Component of the RSC chromatin remodeling complex; essential for viability and mitotic growth; homolog of SWI/SNF subunit Swi3p, but unlike Swi3p, does not activate transcription of reporters
DictyBase DDB_G0277033 1.0003081162615753e-33
Description: swi3 on chromosome: 2 position 7295274 to 7299183
WormBase WBGene00004203 4.000054831110256e-33
Description: locus:swsn-1 status:Confirmed UniProt:G5EF87 protein_id:CAB54337.2
Stentor Coeruleus SteCoe_12813 1.4251640827409352e-21
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00584840(coding)
ATGAAATAAAAAAAAAATCAGATAGTTATAAATTTGTTAAAGTTACCCAACAATTCATAC
TAGGTTATCGATTAAGAACAAGAAGATACAAAACCTAGTCAGCAGCAAACATCCTCATCA
AAGAAAGGTGGAAAAAGTCAAGTATCAAAGTAGTAGTCTTAGTAACCTCCTCTTTCTCCT
GAATCTAGCAATCCAATTATTCCTTAAAATCCTCCTCCAACAAATCTTTCTCTATCAGCT
TAATAAACTCCTTAAACAAGCTAAAATCAATCTGTATAATAAAATTCTTAATAAGCTAAT
TCTTAAATTGCTAATCAGTAATCATAACCATAAAATTCCATGCAAGGAGGATCTAATTTA
CAAGCTCCTTAAGCTTAAGTTAATTAATAGGTACAGTAAGCATAGCCTCCTGTTCAATAA
CCAGTTGCACCTTAGGTATAATAGCCACCTAAAGCAAATCCAACATTTATTCCTACTGCA
GCTCCTCCTAGTTTAATTATCAGAGGTGAAGAAAATTCAAAGGATATTTTCCCTTATACT
TCTTTTGCACAAGAAAAGTATCATTAAAGCATGGGAAACGGTGGTTAAAATATGGGAGAA
AATAAGTCGGAAAAATCATAGAAAAAGTATTAAGTTGTGCTTCCTTCTTGCTCTCACTGG
TTTGAAATGGAAAAGATTCATCAAATTGAAAAGGAGAGTCTTCCTGAATTTTTCTAAGGA
AAACCTTCTAAAACTCCTGAAATATACAAGAGATACAGAAACTTTATCGTCGCCTTGTAT
AGAGAAAATCCTAGAGTTTACTTGACTGCTACTGCATGCAGACGTAACTTAGCTGGTGAT
GTATGTGCTATCCTTAGAGTGCATGCCTTTTTAGAACATTGGGGTATAATTAACTTCAAC
TGTGATCCTAAACTCACTCCTTAATCTATTCTTCTCTCTAAGCCAACTCTTGCTAATCAA
TCTATCTACAAATTCACAAACTAATCAAAGAAGATAGACTTACTAGATTAAGACAGGGAT
CTGTTTTAGGAAGGAGGTGAAGGAGATTTAGTATTTAATTCTATTAAATTACTATCAAAA
AATCAAAGACCCATTTGTGATTTTTGCGGAGTTATTTGTGGTTTAGTGTGGTTCTAATAA
AAGTAAGTTTAAGAAAACTAACCTTGTATGGTTCTTTGCATAAAATGTTACACCGAAGGA
AACTATCCCAGTTTTTTGAGTGATAGAGACTTTGAGAAATCAGATTTAATAAATAAACTT
TCTAGCAATGATTCTAAGCAAAATCTCTCTTAGAGACCTTGGACTCCATAAGAAACTCAT
AAACTTCTTGAAAAAATCGAAGAATATAAGGAGAATTGGGATGAAATCGTAAAGTCTCTT
GATGGCCGTACAAGAGAAGAAATCATCCTTCACTTCCTTAGACTTCCTCTTAAGAATATC
TCATAAGTACGCTTATTTGAAAACGAAGATGACAATAATATTGGTAGATAACCTTATGAA
GAAATAGCAGATGATGAACCAACTGTTTTTTCTGATTTTTCAAATCCTCTAATTTAGCAT
ATAGCAATCTTTAAAAGCTTATTAGATAAGCACAAATAAAAAAAACAAAGTATTAAGGCT
TCTGCTAAATCAAGTTAACCTTAAAAAATTGAATAAAAAGAAGAAAATGTAGAAGGAGGT
ACAAATAGTTAGATAAAAGAAGAGGATGAGATATAGGAAGAATAAAAATAATAAAATTAA
AGTAAAGAAGGATAAGATATGGAAGTAGAAATTGCAGAATAAGCTCCTTCATAATCAGCT
GTGAACGGCGTTGCTAAGGGCGAAACTGTAATTTAAGAAGAAGTAGAAGAATAAGTTCAA
GTTTAGGACAGTTTAAAAAAAAAAGAAGATAAGAGGTTGGGATTAATTGAAGAAGTTAGC
AATTCAAACGCTGATGATCTGTTAGAGATTGAAAATATCACAAAAGAGAGAGCTAAAAAG
CTACAAGAAAGAGAAGAAAGCAAAATTAAAAAACTTGTTCAAAGTTTGATTTATTGTTAA
TTGAGTAAATTAGAGAGCAAATTAAATTACTTAGAAGAGTATGAAAAGCTAATTTGGTAT
GAACGTAACTAACTAGAAGTCACACAAAGTAATCACATTGCAGAAACAGTTAGTCTTGCT
TATCGCAGAAATGAATTCAATAAAGAATTCACAAGAACATATCAAGAATAACACAGAAGA
TAAATGAATTAGTAGTAGCAACCTGGAATGCCACCAGTACCATTTTAAAATCAAGGATAA
TAAGTACCTCCTATTGCACCAATTACTGGAACATCTCCATCTAATTAGGCATAACAATAA
TAATATCCTTAATAAAATGTTCCCAATAGCTAACCGGTAAATGCAAGTGGCTATTAATAG
TAATATCCTTAAAACTAAGGTGGCTCCTAATAAAATATTCCTTATGCCCCTAATCAAGCT
TATCATAAGCCTCCAGCATAATAGTATGGTGCTCCAGGCTATCAGTAACAGCCTCCAATT
CAAAATCCACCAATCTAGCCTATTTAATAATAACAATAAGCACAAATACCTAATACTCAA
TAAAATTATTAACATTATCCCTAAGGTATATAAAACTAGGGAGGATACTATGGTAATCCT
TAAAGAGGTTTAAGTTAAGAATCAACACCAACAAACAGTAATCCTATGCTTCACTAAAAT
CCATAGTAAGTGCTTTAAACTGCTCCAGTAAACTAAGCTCCAAGCTCCCAAAGCATAATT
GGTGGTCCTACTGGATAACACAATTTAAGCAGTTAACCATAAATCCCAGTCTAAGCACCT
CCTGTACCATAAGGGCAATATGATAGTAGCTAAGGAATGAATATAGAAGAATAAAACTAT
TTTAGTTAAAATGATTAATAAGAACCAATTAATAATTTAGGAGATTATCCCTAATAAACA
GAGCCAATTGCTGAATACACATAAGCTGATTAAGGTTACTAGCAAGATTATTCCCAATAA
ATGTATGATTAAACTGAAAAAATTGATTAGTGA


>TTHERM_00584840(gene)
ATGAAATAAAAAAAAAATCAGATAGTTATAAATTTGTTAAAGTTACCCAACAATTCATAC
TAGGTTATCGATTAAGAACAAGGTTAGCATTTTTACATAATTTTTAGATGGAAATCTTAG
AAAGCACTTTATTTAAAAAAGCGAATAGTTATTTTAATTCATTAAACAGTTTATAAAAAA
TGTTATTATAAAAAGAGTTTTTAAGAAAAAATTATTATGATTATTATTTTTGGTTTAAGG
CTAATTCGCTTAAAAAATAAAAAGCTATGCTCTTTGAAAAAATCTATTGTTTTTATAGAG
ATTTCTGAGATAAAATCTTTTTTTTGAAAGTATTTTAAGTTGAATTAAACATAAAAAATA
GAAGATACAAAACCTAGTCAGCAGCAAACATCCTCATCAAAGAAAGGTGGAAAAAGTCAA
GTATCAAAGTAGTAGTCTTAGTAACCTCCTCTTTCTCCTGAATCTAGCAATCCAATTATT
CCTTAAAATCCTCCTCCAACAAATCTTTCTCTATCAGCTTAATAAACTCCTTAAACAAGC
TAAAATCAATCTGTATAATAAAATTCTTAATAAGCTAATTCTTAAATTGCTAATCAGTAA
TCATAACCATAAAATTCCATGCAAGGAGGATCTAATTTACAAGCTCCTTAAGCTTAAGTT
AATTAATAGGTACAGTAAGCATAGCCTCCTGTTCAATAACCAGTTGCACCTTAGGTATAA
TAGCCACCTAAAGCAAATCCAACATTGTAAATAAAATAATTTAGATTTAGGAAAATTGAA
TTAGATAAAATAAACAATCAATCAAACAAAATATTTGAAAATTGTTTTTAGACAAAAATG
TATTAAAAAATTTTAATTTGAATTAATAAAGTATTCCTACTGCAGCTCCTCCTAGTTTAA
TTATCAGAGGTGAAGAAAATTCAAAGGATATTTTCCCTTATACTTCTTTTGCACAAGAAA
AGTATCATTAAAGCATGGGAAACGGTGGTTAAAATATGGGAGAAAATAAGTCGGAAAAAT
CATAGAAAAAGTATTAAGTTGTGCTTCCTTCTTGCTCTCACTGGTACAAAATTTGAATTA
GTTTAAATAATTCGGATATTAGGTTTAATTTAAATAATATAAAATGCTAAATTGTATTTT
ATTCTAATATTAGACGCCTCAAAATATATTTTTAAATTATTATTTAACTTATTTAAACAG
ATATTTATTTATTTATTTTAAATGTTAATAGGTTTGAAATGGAAAAGATTCATCAAATTG
AAAAGGAGAGTCTTCCTGAATTTTTCTAAGGAAAACCTTCTAAAACTCCTGAAATATACA
AGAGATACAGAAACTTTATCGTCGCCTTGTATAGAGAAAATCCTAGAGTTTACTTGACTG
CTACTGCATGCAGACGTAACTTAGCTGGTGATGTATGTGCTATCCTTAGAGTGCATGCCT
TTTTAGAACATTGGGGTATAATTAACTTCAACTGTGATCCTAAACTCACTCCTTAATCTA
TTCTTCTCTCTAAGCCAACTCTTGCTAATCAATCTATCTACAAATTCACAAACTAATCAA
GTAAGAAATTTAAATTTTATCAAGAAAGAATTAGCAGTTTTTAATTAATATTTTCTCTAG
TTACTTAAGCAATATTTAAAATTATTTTAATTACTTATTAGAGAAGATAGACTTACTAGA
TTAAGACAGGGATCTGTTTTAGGAAGGAGGTGAAGGAGATTTAGTATTTAATTCTATTAA
ATTACTATCAAAAAATCAAAGGTAATTAGTTAATATTAAAGTAAATTTAGTAAATAAAAA
TTTTGATAAATAGACCCATTTGTGATTTTTGCGGAGTTATTTGTGGTTTAGTGTGGTTCT
AATAAAAGTAAGTTTAAGAAAACTAACCTTGTATGGTTCTTTGCATAAAATGTTACACCG
AAGGAAACTATCCCAGTTTTTTGAGTGATAGAGACTTTGAGAAATCAGATTTAATAAATA
AACTTTCTAGCAATGATTCTAAGCAAAATCTCTCTTAGAGACCTTGGACTCCATAAGAAA
CTCATAAACTTCTTGAAAAAATCGAAGAATATAAGGAGAATTGGGATGAAATCGTAAAGT
CTCTTGATGGCCGTACAAGAGAAGAAATCATCCTTCACTTCCTTAGACTTCCTCTTAAGA
ATATCTCATAAGTACGCTTATTTGAAAACGAAGATGACAATAATATTGGTAGATAACCTT
ATGAAGAAATAGCAGATGATGAACCAACTGTTTTTTCTGATTTTTCAAATCCTCTAATTT
AGCATGTAAGAAAACAAAAAATTAATTTATTAATAACTCAGTTTTTAGCAATTTAAAATT
AATATTATTTTTATGAATAATCATGATTAGATAGCAATCTTTAAAAGCTTATTAGATAAG
CACAAATAAAAAAAACAAAGTATTAAGGCTTCTGCTAAATCAAGTTAACCTTAAAAAATT
GAATAAAAAGAAGAAAATGTAGAAGGAGGTACAAATAGTTAGATAAAAGAAGAGGATGAG
ATATAGGAAGAATAAAAATAATAAAATTAAAGTAAAGAAGGATAAGATATGGAAGTAGAA
ATTGCAGAATAAGCTCCTTCATAATCAGCTGTGAACGGCGTTGCTAAGGGCGAAACTGTA
ATTTAAGAAGAAGTAGAAGAATAAGTTCAAGTTTAGGACAGTTTAAAAAAAAAAGAAGAT
AAGAGGTTGGGATTAATTGAAGAAGTTAGCAATTCAAACGCTGATGATCTGTTAGAGATT
GAAAATATCACAAAAGAGAGAGCTAAAAAGCTACAAGAAAGAGAAGAAAGCAAAATTAAA
AAACTTGTTCAAAGTTTGATTTATTGTTAATTGAGTAAATTAGAGAGCAAATTAAATTAC
TTAGAAGAGTATGAAAAGCTAATTTGGTATGAACGTAACTAACTAGAAGTCACACAAAGT
AATCACATTGCAGAAACAGTTAGTCTTGCTTATCGCAGAAATGAATTCAATAAAGAATTC
ACAAGAACATATCAAGAATAACACAGAAGATAAATGAATTAGTAGTAGCAACCTGGAATG
CCACCAGTACCATTTTAAAATCAAGGATAATAAGTACCTCCTATTGCACCAATTACTGGA
ACATCTCCATCTAATTAGGCATAACAATAATAATATCCTTAATAAAATGTTCCCAATAGC
TAACCGGTAAATGCAAGTGGCTATTAATAGTAATATCCTTAAAACTAAGGTGGCTCCTAA
TAAAATATTCCTTATGCCCCTAATCAAGCTTATCATAAGCCTCCAGCATAATAGTATGGT
GCTCCAGGCTATCAGTAACAGCCTCCAATTCAAAATCCACCAATCTAGCCTATTTAATAA
TAACAATAAGCACAAATACCTAATACTCAATAAAATTATTAACATTATCCCTAAGGTATA
TAAAACTAGGGAGGATACTATGGTAATCCTTAAAGAGGTTTAAGTTAAGAATCAACACCA
ACAAACAGTAATCCTATGCTTCACTAAAATCCATAGTAAGTGCTTTAAACTGCTCCAGTA
AACTAAGCTCCAAGCTCCCAAAGCATAATTGGTGGTCCTACTGGATAACACAATTTAAGC
AGTTAACCATAAATCCCAGTCTAAGCACCTCCTGTACCATAAGGGCAATATGATAGTAGC
TAAGGAATGAATATAGAAGAATAAAACTATTTTAGTTAAAATGATTAATAAGAACCAATT
AATAATTTAGGAGATTATCCCTAATAAACAGAGCCAATTGCTGAATACACATAAGCTGAT
TAAGGTTACTAGCAAGATTATTCCCAATAAATGTATGATTAAACTGAAAAAATTGATTAG
TGA


>TTHERM_00584840(protein)
MKQKKNQIVINLLKLPNNSYQVIDQEQEDTKPSQQQTSSSKKGGKSQVSKQQSQQPPLSP
ESSNPIIPQNPPPTNLSLSAQQTPQTSQNQSVQQNSQQANSQIANQQSQPQNSMQGGSNL
QAPQAQVNQQVQQAQPPVQQPVAPQVQQPPKANPTFIPTAAPPSLIIRGEENSKDIFPYT
SFAQEKYHQSMGNGGQNMGENKSEKSQKKYQVVLPSCSHWFEMEKIHQIEKESLPEFFQG
KPSKTPEIYKRYRNFIVALYRENPRVYLTATACRRNLAGDVCAILRVHAFLEHWGIINFN
CDPKLTPQSILLSKPTLANQSIYKFTNQSKKIDLLDQDRDLFQEGGEGDLVFNSIKLLSK
NQRPICDFCGVICGLVWFQQKQVQENQPCMVLCIKCYTEGNYPSFLSDRDFEKSDLINKL
SSNDSKQNLSQRPWTPQETHKLLEKIEEYKENWDEIVKSLDGRTREEIILHFLRLPLKNI
SQVRLFENEDDNNIGRQPYEEIADDEPTVFSDFSNPLIQHIAIFKSLLDKHKQKKQSIKA
SAKSSQPQKIEQKEENVEGGTNSQIKEEDEIQEEQKQQNQSKEGQDMEVEIAEQAPSQSA
VNGVAKGETVIQEEVEEQVQVQDSLKKKEDKRLGLIEEVSNSNADDLLEIENITKERAKK
LQEREESKIKKLVQSLIYCQLSKLESKLNYLEEYEKLIWYERNQLEVTQSNHIAETVSLA
YRRNEFNKEFTRTYQEQHRRQMNQQQQPGMPPVPFQNQGQQVPPIAPITGTSPSNQAQQQ
QYPQQNVPNSQPVNASGYQQQYPQNQGGSQQNIPYAPNQAYHKPPAQQYGAPGYQQQPPI
QNPPIQPIQQQQQAQIPNTQQNYQHYPQGIQNQGGYYGNPQRGLSQESTPTNSNPMLHQN
PQQVLQTAPVNQAPSSQSIIGGPTGQHNLSSQPQIPVQAPPVPQGQYDSSQGMNIEEQNY
FSQNDQQEPINNLGDYPQQTEPIAEYTQADQGYQQDYSQQMYDQTEKIDQ